KEGG   Agrobacterium sp. H13-3: AGROH133_12681Help
Entry
AGROH133_12681    CDS       T01432                                 

Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
agr  Agrobacterium sp. H13-3
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:agr01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:agr00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
linear:1505392..1506330
Genome map
AA seq 312 aa AA seqDB search
MKARAQMDIRLIGAPLQIGAGQLGCEMGPSAYRIAGLTRALEDLGHRVVDTGNVTPAPLR
EFSHPNPAVHHLAETVAWTEALTEAAYRESAAAVPIFLGGDHAISAGTVAGMARRVAESG
RPFFVLWLDAHTDYHTLETTRSGNLHGTPVAYFSGRDGFSGYFPPLSHAVPEENIGMIGI
RSVDPAERAALEDSGITVHDMRSIDEHGVAVLLRAFLARVQAANGLLHVSLDVDFLEPSI
APAVGTTVPGGATFREAHLVMEMLHDSGLVCSLDLVELNPFLDERGRTATLMVDLAASLM
GKRVMDRPTRAG
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgagggctcaaatggatatcaggctgatcggtgcgccgttgcaaatcggagcc
gggcaattggggtgtgagatggggccgagtgcgtatcgcatcgccggtctcacgcgggcg
ctcgaagatttgggccatcgggtggtggataccggcaatgtgacgccggcgccgctgagg
gagtttagccaccccaatccggcggtgcatcatctcgctgagacggtggcctggaccgag
gcgctgacggaggccgcctatcgagaaagtgctgccgccgtgccgatctttcttggcggc
gatcacgcaatttccgcgggcaccgtcgccggcatggcgcggcgggtggcggagagtggc
cggccgtttttcgtgctctggctcgatgcccataccgattaccacacgcttgaaacgacg
cgcagcggcaacctgcacggcacgccggtcgcctatttcagcggtcgcgacggattttcg
ggttactttccgccgctctcccatgcggttcctgaggaaaatatcggcatgatcggcatc
cgcagcgtcgatccagccgagagagccgcactggaagacagcggcatcaccgttcacgac
atgcgctcgatagacgagcatggtgtcgcggttctgctgcgcgcgttccttgcgcgggtg
caggcggcaaacggcctgttgcatgtcagtctcgatgtcgatttcctggaaccgtcgatc
gcgcctgcggtcggcaccacggttccgggtggggcgacgttccgtgaggcgcatctggtg
atggagatgctgcatgatagcgggcttgtgtgcagtctcgatctcgtggagcttaacccg
tttctcgatgagcgcggcaggacggcgacgctgatggtcgacctggctgccagcctgatg
ggcaagcgggttatggaccgcccgacgcgggccggctga

DBGET integrated database retrieval system