KEGG   Agrobacterium sp. H13-3: AGROH133_12681Help
Entry
AGROH133_12681    CDS       T01432                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
agr  Agrobacterium sp. H13-3
Pathway
agr00220  Arginine biosynthesis
agr00330  Arginine and proline metabolism
agr01100  Metabolic pathways
agr01110  Biosynthesis of secondary metabolites
agr01130  Biosynthesis of antibiotics
agr01230  Biosynthesis of amino acids
Module
agr_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:agr00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    AGROH133_12681
   00330 Arginine and proline metabolism
    AGROH133_12681
Enzymes [BR:agr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     AGROH133_12681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ADY67104
UniProt: F0LDV3
Position
linear:1505392..1506330
Genome map
AA seq 312 aa AA seqDB search
MKARAQMDIRLIGAPLQIGAGQLGCEMGPSAYRIAGLTRALEDLGHRVVDTGNVTPAPLR
EFSHPNPAVHHLAETVAWTEALTEAAYRESAAAVPIFLGGDHAISAGTVAGMARRVAESG
RPFFVLWLDAHTDYHTLETTRSGNLHGTPVAYFSGRDGFSGYFPPLSHAVPEENIGMIGI
RSVDPAERAALEDSGITVHDMRSIDEHGVAVLLRAFLARVQAANGLLHVSLDVDFLEPSI
APAVGTTVPGGATFREAHLVMEMLHDSGLVCSLDLVELNPFLDERGRTATLMVDLAASLM
GKRVMDRPTRAG
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgagggctcaaatggatatcaggctgatcggtgcgccgttgcaaatcggagcc
gggcaattggggtgtgagatggggccgagtgcgtatcgcatcgccggtctcacgcgggcg
ctcgaagatttgggccatcgggtggtggataccggcaatgtgacgccggcgccgctgagg
gagtttagccaccccaatccggcggtgcatcatctcgctgagacggtggcctggaccgag
gcgctgacggaggccgcctatcgagaaagtgctgccgccgtgccgatctttcttggcggc
gatcacgcaatttccgcgggcaccgtcgccggcatggcgcggcgggtggcggagagtggc
cggccgtttttcgtgctctggctcgatgcccataccgattaccacacgcttgaaacgacg
cgcagcggcaacctgcacggcacgccggtcgcctatttcagcggtcgcgacggattttcg
ggttactttccgccgctctcccatgcggttcctgaggaaaatatcggcatgatcggcatc
cgcagcgtcgatccagccgagagagccgcactggaagacagcggcatcaccgttcacgac
atgcgctcgatagacgagcatggtgtcgcggttctgctgcgcgcgttccttgcgcgggtg
caggcggcaaacggcctgttgcatgtcagtctcgatgtcgatttcctggaaccgtcgatc
gcgcctgcggtcggcaccacggttccgggtggggcgacgttccgtgaggcgcatctggtg
atggagatgctgcatgatagcgggcttgtgtgcagtctcgatctcgtggagcttaacccg
tttctcgatgagcgcggcaggacggcgacgctgatggtcgacctggctgccagcctgatg
ggcaagcgggttatggaccgcccgacgcgggccggctga

DBGET integrated database retrieval system