KEGG   Agrobacterium sp. H13-3: AGROH133_12755Help
Entry
AGROH133_12755    CDS       T01432                                 

Definition
Cytochrome c2
Orthology
K08738  
cytochrome c
Organism
agr  Agrobacterium sp. H13-3
Pathway
Sulfur metabolism
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:agr00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:agr02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
linear:1526757..1527167
Genome map
AA seq 136 aa AA seqDB search
MRGMMISAFRTLPASMAFFLCIAAPALAEGDAVHGEKVFSRCSTCHSIDAPRTRMGPHLM
GVVGRPIASVADYGHYSQALKDAGAAGRVWTEEELQSFISSPKKAIPGTSMRFFGLWSET
DIADLIAYLKTHPMPQ
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgcggggcatgatgatctcggcattcagaacgcttccggcttcaatggcttttttcctc
tgtattgctgcgccggcattggccgaaggcgatgcggtgcacggggaaaaagttttcagc
cgctgttccacctgccacagcatcgatgcgccgcgcacccgcatgggaccgcatctgatg
ggcgtggtgggcaggccgatagcctccgtagctgattacggacattattcgcaggcgctg
aaggatgccggtgccgcgggtcgggtgtggacggaggaggagctgcagagttttatctcg
agcccaaaaaaggcgatccctggaacctcgatgcgctttttcgggctgtggagcgaaacg
gatattgccgatctgatcgcctatctgaaaacgcatccgatgccgcaataa

DBGET integrated database retrieval system