KEGG   Agrobacterium sp. H13-3: AGROH133_12811Help
Entry
AGROH133_12811    CDS       T01432                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
agr  Agrobacterium sp. H13-3
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:agr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AGROH133_12811
   00052 Galactose metabolism
    AGROH133_12811
   00500 Starch and sucrose metabolism
    AGROH133_12811
   00520 Amino sugar and nucleotide sugar metabolism
    AGROH133_12811
Enzymes [BR:agr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     AGROH133_12811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
linear:complement(1551361..1552266)
Genome map
AA seq 301 aa AA seqDB search
MDLNKTVRKAVIPVAGNGTRFLPATKAMPKEMLTIVDRPVVQYAVDEAMQAGIEHIIFVT
SRNKTAIEDYFDSAPELINTLTRSGKTVQVLQLEKMLPVAGTVSYTRQQVPLGLGHAVWC
ARELVGKEPFALLLPDMVSYGARGCIAGLMELYDEVGGNILGVEECLPEEVSSYGVVGVG
QKVNHGFAVTEMVEKPEPSRAPSNYYLNGRYILQPEIFDILAKQERGAGNEIQLTDGMKR
LAEKQAFHAQKYSGRTFDCGSKQGFIAANVAFSLMRADMEAQVLASVKELVANHESRVQA
A
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggacctgaacaaaactgtcagaaaagccgtcattcccgtagccggcaacggcacgcgg
tttttgcccgccaccaaggcgatgccgaaggaaatgctcacgatcgtcgaccggccggtc
gtgcaatatgccgtcgatgaggcaatgcaggccggcatcgagcacattattttcgtaacc
agccgcaacaagaccgccatcgaagactatttcgacagcgcgcccgagcttatcaacacg
ctcacccgctccggcaagacggtgcaggtgctgcagcttgaaaagatgctgccagtcgca
ggcacagtcagctacacgcgccagcaggtgccgctcggcctcggccacgcggtttggtgc
gcgcgcgaactggtgggcaaggagccttttgcgctgcttttgcctgatatggtttcctat
ggcgcacgcggctgcattgccgggttgatggaactctacgacgaagtcggcggcaatatc
ctcggtgttgaggaatgcctgccggaagaagtgtcatcctacggcgtcgttggtgtcggc
cagaaggtcaatcacggctttgcggtgaccgaaatggtcgagaagccggaaccatccagg
gcgccttcgaattattatctaaacggccgttatattctgcagccggaaatcttcgacatt
ctcgccaaacaggagcgtggcgcgggcaacgaaatccagctgactgacggcatgaagcgg
ctcgctgagaagcaggccttccatgcgcagaagtatagcggtcgcacattcgactgcggc
agcaagcagggcttcatcgccgccaatgtcgctttctcgctgatgcgtgccgacatggag
gcgcaggttctcgcttccgtcaaggaactcgtcgcaaaccatgaaagccgcgttcaggcg
gcctga

DBGET integrated database retrieval system