KEGG   Agrobacterium sp. H13-3: AGROH133_12868Help
Entry
AGROH133_12868    CDS       T01432                                 

Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
agr  Agrobacterium sp. H13-3
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:agr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AGROH133_12868
Enzymes [BR:agr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     AGROH133_12868
Exosome [BR:agr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AGROH133_12868
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
linear:complement(1580555..1582762)
Genome map
AA seq 735 aa AA seqDB search
MKKPLNSAEEKKTGEITKAEIEAIKSGLHSNPFALLGVHETPGGFSARCFIPGAEEVSVL
TLDGSFVGELKQLDPEGFFEGPVDLTMRQPVRYRACRDDAEWAVTDPYSFGPVLGPMDDY
FVREGSHLRLFDKMGAHPLKLEGVEGFHFAVWAPNARRVSVVGDFNNWDGRRHVMRFRKD
TGIWEIFAPDVYAGCAYKFEILGANGELLPLKADPYARRGELRPKNASVTAPELAQKWED
QAHREHWAQVDQRRQPISIYEVHAGSWRRREDGTFLSWDEMATQLIPYCTDMGFTHIEFL
PITEHPYDPSWGYQTTGLYAPTARFGDPEGFARFVNGAHKVGIGVILDWVPAHFPTDEHG
LGLFDGTALYEHADPRQGFHPDWNTAIYNFGRIEVLSYLVNNALYWAEKFHLDGLRVDAV
ASMLYLDYSRKEGEWIPNEYGGRENLESVRFLQKMNSLVYGTHPGVMTIAEESTSWPKVS
QPVHEGGLGFGFKWNMGFMHDTLSYFSREPVHRKFHHQELTFGLLYAFTENFVLPLSHDE
VVHGKGSLIAKMSGDDWQKFANLRSYYGFMWGYPGKKLLFMGQEFAQWSEWSEKGSLDWN
LRQYPMHEGMRRLVRDLNLTYRSKAALHARDCEPEGFQWLVVDDHENSVFAWLRSAPGEK
PVAVICNLTPVYRENYYVPLPVAGRWREILNTDAEIYGGSGKGNGGRVQAVNAGGEIGAM
LVLPPLATIMLEPEN
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaccgctcaattcggccgaagagaaaaagactggcgaaatcacgaaggctgaa
atcgaggcgatcaagagcggtttgcattccaacccctttgcacttctcggcgttcacgaa
acgccgggaggtttttctgcacggtgtttcattccgggggctgaagaagtgtctgtcctc
acactggacggatctttcgtcggcgaactgaagcagctcgatcctgagggtttcttcgaa
ggcccggtcgatctcaccatgcgtcagccggtgcgttatcgcgcctgtcgcgacgatgcg
gaatgggcagtgaccgacccctacagctttggtccggttcttggaccgatggacgattat
ttcgtccgcgagggatcgcatctgcgactgttcgacaagatgggcgctcatccgctcaag
cttgaaggcgtcgaaggtttccacttcgccgtctgggctcccaatgcgcggcgcgtctcc
gtcgtcggcgatttcaacaattgggatggtcgacggcatgtgatgcgcttccgcaaggat
accggcatctgggaaattttcgcacctgacgtctatgccggctgcgcctataaattcgag
attctcggcgcaaacggcgagcttctaccgctgaaggccgacccctatgcacggcgtggt
gaactgcggccgaagaacgcctccgtcaccgcaccagaactggcgcagaaatgggaagat
caggcccaccgggaacattgggcgcaagtggaccagcgccggcagccgatcagcatttac
gaggtgcacgccggttcctggcggcgtcgcgaggacggcaccttcctcagctgggacgaa
atggccacccagctcattccctattgcacggatatgggcttcacccatatcgagtttctg
ccgatcaccgaacatccctacgatccgtcctggggttaccagacgaccgggctttatgcc
ccgaccgcccgtttcggcgatccggaaggtttcgcccgcttcgtcaacggcgcccacaag
gtcggcatcggcgtgatcctcgactgggttcccgcgcattttccaaccgacgagcacggc
ctaggcctgtttgacgggacagcgctttacgaacatgccgacccgcgtcagggttttcac
cccgactggaacacggccatctacaatttcggccgcattgaggtattgtcctacctcgtc
aacaacgcgctttattgggccgaaaaattccatctcgatggattgcgcgtcgatgccgtc
gcctcgatgctctatctcgattattcccgcaaggaaggcgagtggatccccaacgaatat
ggcgggcgcgagaacctggaatccgtccgcttcctgcagaagatgaactcgctcgtctac
ggcacccatccgggcgtcatgaccattgctgaagaatccacctcctggccgaaagtgtcg
cagccggttcacgagggcggcctcggtttcggcttcaaatggaatatgggtttcatgcac
gacaccctgagctatttctcgcgtgagccggtgcaccgcaagttccaccatcaggaactg
accttcgggctgctttatgccttcaccgaaaatttcgtgctgccgctttcccatgacgaa
gtagtgcacggcaagggatcgttgatcgccaagatgtccggcgacgactggcagaaattt
gccaatctccggtcctattacggcttcatgtggggttatcccggcaagaagctgctgttc
atggggcaggagttcgcccagtggagcgaatggagcgaaaagggatcgctcgactggaac
cttcgccaatatccgatgcatgagggtatgcgccgcctcgtgcgcgatctcaacctcacc
taccgttcgaaagccgctctgcacgcccgtgactgcgaacccgaaggtttccaatggctg
gtggtcgacgatcacgagaattccgtcttcgcctggctgcgctcggcgcccggcgaaaaa
ccggtggcggtcatctgcaatctgaccccggtctaccgggaaaactattatgtgccgctt
cctgttgcggggcggtggcgggagattctcaacaccgatgccgaaatttatggcggcagc
ggcaagggaaatggcggacgcgttcaggcggtcaatgccggtggggaaatcggggcgatg
ctcgtcctgccgcccttggcaacgatcatgctcgaaccggaaaactga

DBGET integrated database retrieval system