KEGG   Agrobacterium sp. H13-3: AGROH133_13313Help
Entry
AGROH133_13313    CDS       T01432                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
agr  Agrobacterium sp. H13-3
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:agr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AGROH133_13313
Enzymes [BR:agr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     AGROH133_13313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
linear:complement(1793518..1794414)
Genome map
AA seq 298 aa AA seqDB search
MRAFVIGNIALDETYSVSALPEAGASIFGRQAFRDLGGKGCNQAIVMARCGLDTTLTAAV
GTDDRSATIRARLATEPLTADLIGMDGQTSDLSIIFNTPDGENSIVTTTACAQSLTPEDV
AGTLGTASPGDLLVVQGNLGETTTRLALSQAKATGMITAFNPSPLQPWFESLWPLTDIAF
LNRGEAAALTGDTGSTAIKLLISAGVRQVILTLGGEGSMLGTTNQCLTVPAEKTGVVDTT
GAGDCFMAVTLASAALRNVSVDERALRHGAKASALTVSRRGTLSAFPDILELADILSN
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgccttcgtcatcggcaatatcgcgctcgacgaaacctattccgtttccgccctg
ccggaagccggggcttcgattttcggccggcaggccttccgcgatcttggcggaaaaggc
tgcaatcaagccattgtcatggcccgatgcgggctcgataccacattgactgctgctgta
ggtacagatgacaggtctgcgaccatccgcgcccgccttgcaaccgaacctctgaccgcc
gacctcattggcatggatgggcagaccagcgatctctccatcatcttcaacacgcccgat
ggtgaaaacagcatcgtcacgaccactgcctgcgcacaatccctgaccccggaagacgtg
gccggaacccttggtacagccagccccggcgaccttctcgtcgtgcaaggcaatctgggc
gaaacaaccacccgtctcgcactgtcgcaggcaaaggcaacgggaatgatcaccgcattc
aatccgtcacctctccaaccctggtttgaaagtctctggccgctcacggacatcgctttc
ctcaaccgcggcgaagcggccgccctgaccggggataccggctcgacagcgataaaattg
ctcatttcagccggtgtccgccaggtcatcctcacccttggcggcgagggttcgatgctt
ggcacgacaaaccaatgcctgaccgtgcccgccgaaaaaactggcgttgtcgacacgacg
ggtgctggcgattgcttcatggccgtcacgctggcctccgccgcgttgagaaacgtcagt
gtggatgaacgggcgttgaggcatggcgcaaaggcatctgcgctgaccgtcagtcgtcgg
ggcacgctttcagcctttcccgatatccttgagctcgcggatattttgtccaactga

DBGET integrated database retrieval system