KEGG   Agrobacterium sp. H13-3: AGROH133_13320Help
Entry
AGROH133_13320    CDS       T01432                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
agr  Agrobacterium sp. H13-3
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:agr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AGROH133_13320
Enzymes [BR:agr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     AGROH133_13320
Peptidases [BR:agr01002]
 Cysteine Peptidases
  Family C44
   AGROH133_13320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
linear:1801875..1803827
Genome map
AA seq 650 aa AA seqDB search
MCGIAGFYRHDMPAEHANERLALMASRLKHRGPDAHGALLRCDVGLAHARLAIVGIADGT
QPMRTVEDDLAISFNGEIFNHVELRETLSARGHHFRTHSDTEVILHDYRDKGLDCLNEFN
GDFAFALHDARNDTLVLARDRMGVRPLYYTWHEGTFYFASEIGALLALPGMTAEIDPVAL
DQIFTFWFPLPPRTAFRGIHELPPGHLMILRDGASTVRRWWQLSYPDGKDAAPPASLGAQ
VEELTALLADATRIRLRADVPVGSYLSGGLDSSLVSALAAQSVSRGLRTFSLAFESAEHD
ESIWQKTMSQHLGVASETTECSTADIAQYMPEVMEHVQTPILRTAPVPLYLLSRHVRERG
MKVVLTGEGADELFAGYDIFREARVRRFCSRQPQSARRPKLFQRLYPYLPGLKQQTPDYL
ARFFSFGAEATDEPLFSHRPRLRSTAAAKIFFSAELKAQLGDYDAAADLAAQLPEDFRRW
HPLHQAQYLETAFLLPGYILSSQGDRVMMANGVEGRFPFLDPRVVDFAAALHPEAKLRGL
KEKYILKQAAAELVPDAILYRPKQPYRAPDAEAFADAGYLETVLSTGQVRTTGLFNAQAV
EKLTTKVRQKQATGFRDNAAFVGILSTQLLHAATTQNSTMSSQKIEGSSK
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaattgccggattttatcgacacgacatgccggccgagcacgcaaacgagcgc
cttgcgctgatggcgtcgcgtcttaagcatcgtggtccagatgcgcatggagccctgctg
cgctgcgatgtcggccttgcccacgcacggctggcgattgtgggcattgccgatggcacg
cagccgatgcgcaccgtcgaagacgatcttgccatttccttcaacggtgaaatcttcaat
cacgtcgaactgcgcgaaacgctgtccgcacgcggccaccatttccgcacccactccgac
accgaagtcatcctgcatgactatcgcgacaaggggctggattgcctcaacgaattcaac
ggcgattttgccttcgccctgcacgacgcccgcaatgacacgctggtgcttgcgcgtgac
cggatgggtgtccggccgctttattatacgtggcatgaaggtacgttttatttcgcatcc
gagatcggggcgcttctggcgttgccgggaatgacggccgagatcgatccggtggcgctg
gatcagatattcaccttctggttcccgttgccgccgcgcaccgcctttcgcggcattcac
gaattgccgcccggtcatctgatgatcctgcgcgatggcgcgtccacggtacggcgctgg
tggcaactttcctatcctgacggcaaggacgcagcaccgccggcaagccttggcgcgcag
gtggaagagctgacggcgcttctggccgacgcaacgcggatcaggcttcgcgccgatgtg
cctgtcggctcctatctgtccggcgggctcgattcctccctcgtttctgccctggctgcg
caaagcgttagccgaggcctgcgcacattttcgctggccttcgaaagtgcggagcacgac
gaaagtatctggcagaaaacaatgagccagcatcttggcgtcgcatccgaaaccacggag
tgctcaactgcggacatagcgcaatacatgcctgaggtcatggagcacgtgcagacgccc
attcttcgcacagcaccggtgccgctttacctgctttcccggcatgtgcgcgaacgggga
atgaaggtggtgctgaccggtgaaggtgctgatgagctgttcgctggctacgatattttc
cgcgaagcgcgggtacggcgcttttgcagccgccagccgcaatcggctcgccggccgaaa
ctgttccagcggctttatccctaccttccggggctgaaacagcagacgccggattatctg
gcacgcttcttctccttcggcgcagaagccaccgacgaaccgctgttttcccatcggccg
cgcttgcgctctacggcggcggcgaaaatcttcttttcagcggaattgaaagcgcagctt
ggcgactacgacgctgcggccgatcttgccgcgcagttgccggaggatttccgccgctgg
catccgcttcatcaggcgcagtacctcgagacagcatttctcttgcccggctatattctg
tccagtcagggagaccgggtcatgatggcaaatggagtggaaggccggtttccgttcctc
gatccccgtgtggtggactttgccgcagcgctccatcccgaggcgaaactgcgcggtctg
aaggaaaagtatatcctcaaacaggctgcagccgagctggtgcccgatgcgatcttatac
cgacccaagcagccctatcgcgcgcccgacgcagaagccttcgcggatgccggctatctc
gaaaccgtactttctaccggtcaagtgaggaccaccggcctgttcaatgcccaggcggtg
gaaaagctgacaaccaaggtgcggcaaaaacaggcgaccggctttcgcgacaacgccgcc
ttcgtcggcatactctcgacccagcttctgcatgctgccacgacccagaattccacaatg
tcatcgcaaaaaatcgaaggaagctccaaatga

DBGET integrated database retrieval system