KEGG   Agrobacterium sp. H13-3: AGROH133_13769Help
Entry
AGROH133_13769    CDS       T01432                                 

Definition
Xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
agr  Agrobacterium sp. H13-3
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:agr00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:agr00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
linear:1977048..1978358
Genome map
AA seq 436 aa AA seqDB search
MSTGFFGDIAKIKYEGPDSTNPLAFRHYNPDEIVAGKRMEDHLRFAVAYWHTFTWPGGDP
FGGQTFQRPWFEDTMQAAKLKADVAFEFFSLLGSPFYCFHDADVRPEGRNFAENTRNLNE
IVDYFAQKQADTGVKLLWGTANLFSNRRFMSGAATNPDPDVFAFSAATVKTCMDATKKLG
GANYVLWGGREGYETLLNTDLSRELDQLGRFLNLVVEYKYKIGFEGTILIEPKPQEPTKH
QYDYDVATVYAFLQKNGLEKEVKVNIEQGHAILAGHSFEHELAMANAFGIFGSIDMNRND
YQSGWDTDQFPNNVPEMALAYYHVLAGGGFTNGGTNFDSKLRRQSLDPQDLLIGHIGGMD
CCARGLKAAAKMIEDGALSKPLSERYAKWDAPEAQKMLRGELKLEEIAALVERQDINPEP
KSGRQEYLENVVNRYV
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaggcttcttcggcgatatcgccaagatcaaatatgaaggccccgacagcacc
aacccgctcgccttccgccactacaaccccgacgagatcgttgccggaaagcgtatggaa
gatcacctgcgctttgccgtggcttactggcacaccttcacctggccgggcggcgaccca
ttcggtgggcagacgttccagcgtccgtggtttgaagacaccatgcaggccgccaagctg
aaggccgatgtcgcctttgaattcttctcgctgctcggttcgccgttctattgcttccac
gacgccgatgtgcgcccggaaggcaggaactttgccgaaaacaccaggaacctcaacgag
atcgtcgactacttcgcgcagaagcaggctgataccggcgtaaagcttctgtggggcacg
gcgaacctgttctccaaccgccgcttcatgtcgggtgccgcgaccaatccggacccggat
gtcttcgcattctcggctgcgacggtgaagacctgcatggatgccaccaagaagctcggc
ggcgccaattacgtgctatggggcggtcgtgaaggttacgaaacgctgctcaacaccgat
ctttcgcgcgagctggaccagctcggccgcttcctcaatctggttgtggaatacaaatac
aagatcggtttcgaaggcacgatcctgatcgagccaaagccgcaggagccgaccaagcac
cagtacgactacgacgtcgcaaccgtttatgcgttcctgcagaagaacggtctcgaaaag
gaagtgaaggtcaatatcgagcagggtcacgccatcctcgccggccattccttcgaacac
gaactggccatggccaatgccttcggcattttcggctcgatcgacatgaaccgcaacgat
taccagtctggctgggataccgaccagttccccaacaacgtacctgaaatggcgctagcc
tattaccacgtgctggccggcggcggcttcaccaatggcggcaccaacttcgattccaag
ctgcgtcgccagtcgcttgatccgcaggacctgctgatcggccatatcggcggcatggat
tgctgcgcccgcggtctgaaggcggcggcgaagatgatcgaggacggcgcgctgtcgaag
ccgctttcggagcgttacgcgaagtgggacgcacctgaagcccagaagatgttgcgcggc
gagctgaagctcgaagaaatcgcagcgctggtcgagcgccaggatatcaaccccgagccg
aagtccggtcgtcaggaatatctggagaacgtcgtcaatcgttacgtttga

DBGET integrated database retrieval system