KEGG   Agrobacterium sp. H13-3: AGROH133_13769Help
Entry
AGROH133_13769    CDS       T01432                                 

Definition
Xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
agr  Agrobacterium sp. H13-3
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:agr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AGROH133_13769
   00051 Fructose and mannose metabolism
    AGROH133_13769
Enzymes [BR:agr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     AGROH133_13769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
linear:1977048..1978358
Genome map
AA seq 436 aa AA seqDB search
MSTGFFGDIAKIKYEGPDSTNPLAFRHYNPDEIVAGKRMEDHLRFAVAYWHTFTWPGGDP
FGGQTFQRPWFEDTMQAAKLKADVAFEFFSLLGSPFYCFHDADVRPEGRNFAENTRNLNE
IVDYFAQKQADTGVKLLWGTANLFSNRRFMSGAATNPDPDVFAFSAATVKTCMDATKKLG
GANYVLWGGREGYETLLNTDLSRELDQLGRFLNLVVEYKYKIGFEGTILIEPKPQEPTKH
QYDYDVATVYAFLQKNGLEKEVKVNIEQGHAILAGHSFEHELAMANAFGIFGSIDMNRND
YQSGWDTDQFPNNVPEMALAYYHVLAGGGFTNGGTNFDSKLRRQSLDPQDLLIGHIGGMD
CCARGLKAAAKMIEDGALSKPLSERYAKWDAPEAQKMLRGELKLEEIAALVERQDINPEP
KSGRQEYLENVVNRYV
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaggcttcttcggcgatatcgccaagatcaaatatgaaggccccgacagcacc
aacccgctcgccttccgccactacaaccccgacgagatcgttgccggaaagcgtatggaa
gatcacctgcgctttgccgtggcttactggcacaccttcacctggccgggcggcgaccca
ttcggtgggcagacgttccagcgtccgtggtttgaagacaccatgcaggccgccaagctg
aaggccgatgtcgcctttgaattcttctcgctgctcggttcgccgttctattgcttccac
gacgccgatgtgcgcccggaaggcaggaactttgccgaaaacaccaggaacctcaacgag
atcgtcgactacttcgcgcagaagcaggctgataccggcgtaaagcttctgtggggcacg
gcgaacctgttctccaaccgccgcttcatgtcgggtgccgcgaccaatccggacccggat
gtcttcgcattctcggctgcgacggtgaagacctgcatggatgccaccaagaagctcggc
ggcgccaattacgtgctatggggcggtcgtgaaggttacgaaacgctgctcaacaccgat
ctttcgcgcgagctggaccagctcggccgcttcctcaatctggttgtggaatacaaatac
aagatcggtttcgaaggcacgatcctgatcgagccaaagccgcaggagccgaccaagcac
cagtacgactacgacgtcgcaaccgtttatgcgttcctgcagaagaacggtctcgaaaag
gaagtgaaggtcaatatcgagcagggtcacgccatcctcgccggccattccttcgaacac
gaactggccatggccaatgccttcggcattttcggctcgatcgacatgaaccgcaacgat
taccagtctggctgggataccgaccagttccccaacaacgtacctgaaatggcgctagcc
tattaccacgtgctggccggcggcggcttcaccaatggcggcaccaacttcgattccaag
ctgcgtcgccagtcgcttgatccgcaggacctgctgatcggccatatcggcggcatggat
tgctgcgcccgcggtctgaaggcggcggcgaagatgatcgaggacggcgcgctgtcgaag
ccgctttcggagcgttacgcgaagtgggacgcacctgaagcccagaagatgttgcgcggc
gagctgaagctcgaagaaatcgcagcgctggtcgagcgccaggatatcaaccccgagccg
aagtccggtcgtcaggaatatctggagaacgtcgtcaatcgttacgtttga

DBGET integrated database retrieval system