KEGG   Agrobacterium sp. H13-3: AGROH133_14958Help
Entry
AGROH133_14958    CDS       T01432                                 

Definition
carboxylesterase (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
agr  Agrobacterium sp. H13-3
Brite
Enzymes [BR:agr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     AGROH133_14958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pAspH13-3a:complement(424602..425507)
Genome map
AA seq 301 aa AA seqDB search
MTFSFAGSQSSLSRPCPHVPADEKTKVFNPSNDGLSFFEEGSNGKAVMLVHGMSGAPAEM
RLVARQFSRRGYSVFAPLLAGHGRGKAALRRSRFEDWLDSTTIAADWLATRSDTVFSAGI
CVGGKLSLLASHMQSSPIKSVALYSPCFHYDGWNVPRYYAILSPHIRWIKLIPFIDRLNF
SETPSLGIKDDRLRRIIAGMENEGVLSHFPGRGLVEMNRLGHYLKKHLPAITTPSLIIHS
TEDDLSGPDHARYIAAKLGGPRALQWLNDSYHMIHVDREHRKVADLSARFFETKHAFRNP
I
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgacgttttctttcgctgggtcacaatccagtctatcccgcccctgcccgcacgttccg
gcagacgaaaagacgaaagtgttcaatccgtcaaacgatggtctttcctttttcgaagag
ggttcgaatggcaaggccgtgatgctcgtgcacggcatgagcggtgctcctgccgaaatg
cgtctggtggcgcgacaattcagccgcaggggttattcggttttcgccccactactcgcc
gggcacgggcgtgggaaagctgccttgcggcgctcccgctttgaagactggctcgacagc
accacgatcgccgcagactggctggcgacgagaagcgacaccgtcttttcggccggcatt
tgcgttggtggaaagctctcgcttctcgcgtcccatatgcaatcgtccccgatcaagtcg
gtcgcactctactcaccctgcttccactacgacggctggaatgttccgcgctattacgcg
atcctttcaccgcatatcagatggataaagctgatacccttcatcgaccgtctcaatttc
agcgagacgccttccctcggcatcaaggacgaccgcctaaggcgcatcattgcgggtatg
gaaaacgaaggcgttctcagccatttccccgggcggggtctcgtcgaaatgaaccgactt
ggccattacctcaagaagcatctgcccgcgatcaccaccccatcgctcatcatccattca
accgaagatgatctcagtggcccggaccacgcccgctatatcgccgcgaagctgggcggc
ccaagagcgctgcagtggttgaacgacagctatcacatgatccacgtggacagagaacat
cgcaaggtcgccgatctctccgcccggttcttcgagacgaaacatgcttttagaaacccg
atttga

DBGET integrated database retrieval system