KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_0036Help
Entry
AHA_0036          CDS       T00424                                 

Definition
lysophospholipase L2 (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:aha00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    AHA_0036
Enzymes [BR:aha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     AHA_0036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(39471..40511)
Genome map
AA seq 346 aa AA seqDB search
MNLLSPALLALTLFSAGALAVNNPYQLTPEADVATLHQQTLPDFWRQHAVESAFKGKDGI
TIRYAALRQAKVDRAILIVNGRVESYLKYQELAWDLWRQGYSLYLIDHRGQGLSDRLLAD
QEKGYVDQFDDYVLDLKQFHDEVIAQDQPAKLFLLAHSMGGAISARYLERWPDDIEAAVL
SSPMMGINLGGLPKWLAKGLAATIGTVGGWLGEPPYGPGQGPYESHDFADNGLSHSEARY
QAFRELYEQRPQIKLGGATAHWIYQGLTGADAAVAEAGAIKTPLLLLQAGDDGVVDNAAQ
DAFCALARCEGGKPLRIEGAWHELFMEADPQRQAALNATLAFFARY
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgttatcgcccgccctgctggccctgaccctgttttctgccggagccctcgcc
gtgaacaatccctatcagctgacgccggaagccgacgtcgccacccttcatcagcagacc
ctgcccgacttctggcgccagcacgccgtcgagagcgccttcaagggcaaggacggaatc
accatccgctatgccgccctgcgccaggccaaggtcgatcgcgccatcctcatcgtcaac
ggccgggtcgaaagctacctcaagtatcaggagctggcctgggatctgtggcgccaaggc
tacagcctctacctcatcgaccaccgcggccagggcttgtccgatcggcttctggccgac
caggagaagggatatgtcgaccagttcgacgattatgtgctcgatctcaagcagtttcat
gacgaggtgatcgcccaggaccagcccgccaagctgttcctgctcgcccactccatgggc
ggcgccatctcggcccgctatctggagcgctggcccgatgatatcgaggcggccgtgctc
tcctcccccatgatgggcatcaatctaggcggcctgcccaagtggctggccaaggggctg
gcggccaccatcggcacggtcggcggctggctgggcgagcctccctacggcccgggccag
ggcccgtacgagagccacgactttgccgacaacggcctgagccacagcgaagcccgctat
caggccttccgcgagctctatgagcagcgcccgcagatcaagttggggggcgccaccgcc
cactggatctatcaggggctgacgggggcggacgccgccgtggccgaggccggcgccatc
aagacgccgctgctgctgctgcaggccggtgatgacggcgtggtggacaacgccgcgcag
gatgccttctgtgcgctcgctcgctgcgagggaggcaagccgctgcgcatagaaggggcc
tggcacgagctgttcatggaggccgatccccagcgccaggccgcgctcaacgcgactctg
gccttcttcgcacgctactag

DBGET integrated database retrieval system