KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_0041Help
Entry
AHA_0041          CDS       T00424                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:aha00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    AHA_0041
Enzymes [BR:aha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     AHA_0041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(44739..45593)
Genome map
AA seq 284 aa AA seqDB search
MAADVGDAPAASYEYFDRLEYDSGRFFIRHLLLKFAAFTSLSIQEFSAFRIWLSPFRAQD
GGLCYNQNTVSLKGTDMAQQGTLYIISSPSGAGKSSLLNALLTQHNSAGKMQLSVSHTTR
ATRPGEEHGVHYHFVKVEEFKALIERGDFLEWAEVFGNYYGTSRAAIEACLAQGIDVFLD
IDWQGARQIREQMPTKSIFILPPSREELERRLIGRGQDSAEVIKGRMEKAIAEMVHYDEY
DYVIINEDFEQALFQLRAVIECQRLELRQQQQAQQNLLQQLLAE
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgatgtgggtgacgctcccgcagcaagctacgaatactttgatcggctggaa
tatgattccggccgtttttttatccgccaccttctgttaaaattcgccgcctttacatcc
ctctcaattcaagaattttccgcgtttcggatttggctgtctccctttcgggcacaagac
ggcggcctctgctacaaccaaaacacggtctcgcttaaaggtacagacatggcgcaacaa
ggcactctctatatcatctcctccccgagcggagcgggtaaatccagcctgctcaatgcc
ttgctgacccagcacaacagcgcaggcaagatgcagctgtcggtttcccacaccacccgc
gccacccgtcccggtgaagagcacggggtgcactaccacttcgtcaaggtggaagagttc
aaggcgctgatcgagcgcggcgactttctggagtgggccgaggtgttcggcaactactac
ggcacctcccgcgcggccatcgaagcctgcctggcacaagggatcgacgtgttcctcgac
atcgactggcagggcgcccgccagatccgcgaacagatgccgaccaagtccatcttcatc
ctgccgcccagccgcgaagagctggagcgccgcctgatcggtcgcggccaggacagtgcc
gaggtgatcaagggccggatggagaaagccattgccgaaatggtgcactatgacgagtat
gactatgtcatcatcaacgaagactttgagcaggcactgttccagctgagggccgtcatc
gagtgccaacggctggaattgcgccagcagcagcaggcccaacaaaacttgctgcaacag
ctactggcagaatag

DBGET integrated database retrieval system