KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_0164Help
Entry
AHA_0164          CDS       T00424                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:aha03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
182978..183790
Genome map
AA seq 270 aa AA seqDB search
MPELPEVEVSRQGISPWLTGIKVTRVVVRDGRLRWPVPGEIQELVDLTIHRVSRRAKYLL
LETDFGTAILHLGMSGSLRVLDIGTPAEKHDHVDIELANGKLLRLNDPRRFGALLWTREP
AEAHALLAKLGPEPLTDAFNADYLRERAKGRSTAIKTFLMDNQVVVGVGNIYANEALYAA
GIHPKRAAGNISAERLGTLVAEIKRVLAEAIRQGGTTLKDFTSADGKPGYFVQQLQVYGR
GGQPCFHCHTLLSEIRLGQRTTVFCSHCQR
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattaccggaagtcgaagtcagccgccagggtatctcgccctggcttaccggc
atcaaggtcacccgagtggtggtgcgggacggccgcctgcgctggccggtgccgggggaa
atccaggagctggtggatctcaccatccaccgggtcagccgccgcgccaagtacctgctg
ctggagaccgacttcggcaccgccatcctccatctgggcatgtcgggcagcctgcgggtg
ctggacatcggcaccccggccgagaagcacgatcacgtggatatcgagctggccaacggc
aagctgctgcggctcaacgatccgcgccgcttcggcgccctgctgtggacccgcgagccg
gccgaggcgcacgcgctgctggccaagctggggccggagccgctcaccgatgcgttcaat
gctgattacctgcgtgagcgcgccaaggggcgcagcaccgccatcaagaccttcctgatg
gacaaccaggtggtggtcggggtgggcaatatctacgccaacgaggcgctctacgccgcc
ggcattcaccccaagcgggcggcgggcaacatcagcgccgagcgcttgggcaccctggtg
gccgagatcaagcgggtgctggccgaagcgattcggcagggcggcaccaccctcaaggat
ttcaccagtgcagacggcaagccgggctatttcgtgcagcagctgcaggtgtacgggcgg
ggcggccagccctgttttcactgccacaccctgctcagtgaaatccggctgggacagcgt
accaccgtgttctgttcccactgccagcgctga

DBGET integrated database retrieval system