KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_0205Help
Entry
AHA_0205          CDS       T00424                                 

Gene name
ebgA
Definition
cryptic beta-D-galactosidase subunit alpha (EC:3.2.1.23)
Orthology
K12111  
evolved beta-galactosidase subunit alpha [EC:3.2.1.23]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aha00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AHA_0205 (ebgA)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    AHA_0205 (ebgA)
Enzymes [BR:aha01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     AHA_0205 (ebgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
221807..224881
Genome map
AA seq 1024 aa AA seqDB search
MNNWENVQFVGENRLAPRAYFFSYADHALAATMQRELSRRFLSLSGQWQFHYFDHPLQVP
EAFYHSPMSEWDQITVPNMWQMEGHGQLQYTDEGFPFPIDVPFVPTNNPTGAYQRSFTLS
QAWDGEQVIIKFDGVETYFEVYVNGHYIGFSKGSRLTAEFDISAYAKVGENLLSVRVMQW
ADSTYIEDQDMWWMAGIFRDVYLVGKPAAHVQDFFIRTALADDNQSATLSCDIQLENLGA
AARDHRLVWSLLDQGSEIASGSLDHLAIDGKCDCRFTLDLANPHLWSAEDPYLYQLQLSL
YNGQGELLEVIPQRVGVREIKVKDGLFYVNGHYLKLHGVNRHDNDHLKSRAVGMDRVERD
IVLMKQHNLNSVRTAHYPNDPRFYELCDQYGLFVMAETDVETHGFANVGDLSRITDDPFW
EPVFVDRIERHVHAQKNHPSIIIWSLGNESGYGCNIRAMYRRCKQMDPTRLVHYEEDRDA
EVVDLVSTMYSRVSQMNCFGEFPMPKPRILCEYAHAMGNGPGGLSEYQQVFDRHPHIQGH
YIWEWCDHGILDQDEQGRPVYKYGGDYGDYPNNYNFCMDGLIYPDQTPGPGLREYKQVIC
PVKVRALDLASGKLEVENRYWFSNLDDIRLLVEVKAEGELLASQQIRLEGVAPGATTELQ
LELPSLDGRETFVQLRVIKATATRYSAAEHELGQYQFQLKESTRQLQPFANPNATALQIA
DERLALTLSGSGFALRFSRLDGKLVSWQQDGNELIERAPRLTFFKPMIDNHKQEYESLWH
PNHLQIMQEHFRTLSWRQLGEVVEVTVESLIAPPVFDFGMRCRYVYTLSPNGQLHVALSG
QPYGGYDDIIPKIGFELGIRQDLDRVHYYGMGPGENYQDSRQSNWIDSFQSTVGEMWEHY
PFPQDNGNRQQVRWATLTNRHGAGLYVRPDAPINLSVWPYSWEHIHAAQHINELEPSGYL
TLNLDHKVLGLGSNSWGSEVLDSWRVRFEPFSFGLTLLPIARGNLNPAALAGLDLTINGG
RNLA
NT seq 3075 nt NT seq  +upstreamnt  +downstreamnt
gtgaataactgggaaaacgtccaattcgttggtgaaaacaggctggctccgcgtgcctac
ttcttctcttatgccgaccatgcgctggcggccaccatgcagcgcgaactgagccgccgt
tttttgagccttagcggccagtggcagttccactacttcgaccatcccctgcaggtgccg
gaggccttctatcacagccccatgagcgagtgggaccagatcaccgtgcccaacatgtgg
cagatggaagggcatgggcagctgcagtacaccgacgaaggttttcccttccccatcgat
gtgcccttcgtgccgaccaacaaccccaccggcgcctatcagcgcagcttcacgctgagc
caggcctgggacggcgagcaggtgatcatcaagtttgacggggtggagacctactttgag
gtctatgtgaacggccactacatcggcttcagcaagggcagccgtctcaccgccgagttc
gatatcagtgcctacgccaaggttggcgagaacctgctgtcggtgcgggtgatgcagtgg
gcggactccacttatatcgaagatcaggatatgtggtggatggcggggatcttccgcgac
gtctatctggtgggcaaaccggccgcccatgtgcaggacttcttcatccgcaccgcgctg
gccgatgacaaccagagcgccacccttagctgcgatatccagctcgagaacctgggtgca
gctgcccgtgatcaccgtctggtctggtcgctgctggatcagggcagcgagatcgccagc
ggctcgctcgaccatctcgccatcgacggcaagtgtgattgtcgcttcacgctggatctg
gccaacccccatctgtggagcgccgaagatccttacctctaccagctgcaactctccctc
tacaacggacagggcgagctgctggaagtgatcccgcagcgggtcggggtgcgtgaaatc
aaggtcaaggatggcctcttctacgtcaacggccactacctcaagctgcacggggtgaac
cgtcacgacaacgaccacctcaagagccgtgcggtcggcatggatcgggtggaacgcgat
atcgtgctgatgaagcagcacaacctcaactcggtgcgcactgcccactacccgaacgac
ccgcgcttctatgagctgtgcgatcagtacggcctgttcgtgatggcggagacagacgtg
gagacccacggttttgccaacgtcggcgatctcagccgcatcacagacgatcccttctgg
gagccggtgttcgtggatcgcatcgagcgccatgttcacgcccagaagaaccacccctcc
atcatcatctggtcgctgggcaacgagtccggctacggctgcaacatcagggccatgtac
cgccgctgcaagcagatggatccgacccgactggtgcactacgaggaagaccgcgatgcc
gaggtggtggatctggtcagcaccatgtattcgcgcgtctcccagatgaactgcttcggc
gagttccctatgcctaagccgcgcatcctctgcgaatacgcccacgccatgggcaacggc
ccgggtggcctcagcgaatatcagcaggtgttcgaccgtcatccccacattcagggtcac
tacatctgggagtggtgcgatcacggcattctggatcaggacgagcagggccgcccggtc
tacaagtacggtggcgactacggcgactaccccaacaactacaacttctgcatggatggc
ctcatctatcctgatcagacccctgggccgggcctgcgcgaatacaagcaggtgatctgc
ccggtcaaggtgcgcgcgctggatctggccagcggcaagctggaagtggaaaaccgttac
tggttctccaatctcgacgacatccgtctgctggtcgaagtgaaggccgagggcgaactg
ctggccagccagcagatccggctggaaggggtggctcccggtgccaccaccgagctgcaa
ctcgaactgccatccctcgatgggcgggaaaccttcgtccagctgcgggtcatcaaggcc
actgccacccgctacagcgcggcggagcacgagctgggccagtaccagttccagctgaaa
gagtcgactcgccagctgcagccctttgccaaccccaatgccacggcgttgcagattgcc
gatgagcggcttgcgctgaccttgagcggcagcggcttcgccctgcgcttctcgcgcctc
gacggcaagctggtgagctggcagcaggatggcaatgagcttatcgagcgggcgccgcgc
ctcaccttcttcaagccgatgatcgacaaccacaagcaggagtacgagagcctgtggcac
ccgaaccacctgcagatcatgcaggagcacttccgcactctgagctggcgtcagctgggt
gaggtggtcgaggtgacggtggagagcctgatcgcgccgccggtgttcgacttcggcatg
cgctgccgctacgtctacaccctgagcccgaacggccagctgcacgtggcactgtccggt
cagccctacggcggctatgacgacatcattcccaagatcggcttcgagctgggtattcgt
caggatctcgaccgggtgcactactacggcatggggccgggcgagaactatcaggacagc
cgccagagcaactggatcgacagcttccagagcacagtcggcgagatgtgggagcactac
cccttcccgcaggacaacggcaaccgccagcaggtgcgctgggcgaccctgaccaatcgc
cacggcgccggtctctacgtgcggcccgatgcccccatcaacctgagcgtctggccctac
agctgggagcacatccacgcggcgcagcacatcaacgagctggagccgagtggttatctc
accctcaatctggatcacaaggtactggggctgggctccaactcctggggttccgaggtg
ctggactcctggcgggtgcgcttcgagccgttcagcttcggcctgaccctgctgcccatc
gcccgtggcaacctcaatccggctgcgctggccgggctcgatctcaccatcaacggcggg
aggaacctcgcatga

DBGET integrated database retrieval system