KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_0468Help
Entry
AHA_0468          CDS       T00424                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:aha00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AHA_0468 (hemD)
Enzymes [BR:aha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     AHA_0468 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(498177..498911)
Genome map
AA seq 244 aa AA seqDB search
MIPLVVRPAAQAAELAALLRQHGHAPLCCPLLETVAGSELHRLPELLPQADIVIAVSVHA
VNFTHHFLLQTGQTWPNIDYFAVGQASADAFSEVGIQALSPDDPRSEGLLALPSLQQVNG
KQVLILRGNGGRDLIARTLASRGALVHYCAAYERHYPALDGDALTCHWQAAGLDSLLVTS
GELLQRLLELVPDQQLPWLHDRLLVVPSPRVAEMAAAAGFTHITIAQGASNQALTAALEL
RKME
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgatcccgctggtggtgcgcccggccgcccaggccgccgagctggcggcgctgctgcgc
cagcacggccacgcaccgctctgctgcccgctgctggaaaccgtggcgggcagcgaactg
caccgcctgcccgaactgctgccccaggccgacatcgtcatcgccgtcagcgtgcatgca
gttaatttcactcatcattttctgttgcaaactggtcagacctggccaaatattgactac
tttgcagtcggccaggccagcgcggatgccttctctgaggtgggcatccaggccttgagc
ccggacgatccgcgcagcgaagggctgctggccctgcccagcctgcaacaggtgaacggc
aagcaggtgctgatcctgcgcggcaatggcggccgggatctcatcgcccggacgctggcc
tcacgcggcgcactggtgcactattgtgcggcctatgagcgccactaccccgcactggac
ggggacgcattgacttgccactggcaggcggccgggctcgacagcctgctcgtcaccagc
ggtgaactgctgcaacggctgctggaactggtcccggaccaacagctgccctggctgcac
gaccgcctgctggtggtgcccagcccgcgggtggccgagatggccgcggcggcgggcttt
acccatatcacgattgcccagggtgcatccaaccaggccctgacggccgctctggaactg
aggaagatggaatga

DBGET integrated database retrieval system