KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_0584Help
Entry
AHA_0584          CDS       T00424                                 

Gene name
cysQ-1
Definition
3'(2'),5'-bisphosphate nucleotidase (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:aha00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
618378..619190
Genome map
AA seq 270 aa AA seqDB search
MQELLAWVPGVKEIAREAGRILHEIYHGGQFERQLKEDATPVTSADLAADAYLKQALSAL
TPHVPVLTEEAADIPFSQRANWRQYWLVDPLDGTGEFIAGSGDFATLIALVQDNVPVLGV
IYAPESNVLYWAVRGHGAFKEANGEVHPISAMHHEHDQPDSLVVAISRRQKLENLTRRLN
PAINYELIPLGSSSLKSCLVAEGAADCYVRLGPTGEWDTAAAQCIVEAAGGRILSLALQP
LRYNETESLENPDFIVMGDPDLAWGSILAH
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgcaggagttgttggcctgggtgccgggggtcaaggagatcgcgcgcgaagcgggccgg
atccttcacgaaatctatcacggcggtcagttcgagcgtcagctgaaggaggatgcgacc
ccggtcaccagtgccgatcttgctgccgatgcctacctcaaacaggcgctgtcggcgctc
actccccacgttcccgtgctgaccgaagaggcggccgacatccctttcagccagcgcgcc
aactggcgccagtactggctggtggatcccctcgacggcaccggcgagttcatcgccggc
agcggcgacttcgccaccttgatcgccctggtgcaggacaatgtgccggtgcttggcgtc
atctatgcccccgagtcgaacgtgctctactgggcggtgcgcggtcatggcgcctttaag
gaggcgaacggcgaggtgcaccccatcagcgccatgcaccacgagcacgatcagcccgat
tcgctggtggtggccatcagccgtcgtcagaagctggagaacctgacccgccgcctcaac
ccggccatcaactacgagctgatcccgctcggctccagctcgctcaagtcctgcctggtg
gcggaaggggcggccgactgctacgtgcggctcggccccaccggcgagtgggacaccgcc
gccgcccagtgcatcgtcgaggcggccggtggccgcatcctcagcctggcgctgcagccg
ctgcgctacaacgagacagagtcgctggagaacccggacttcatcgtgatgggggatccg
gatctcgcctggggcagcattctggcgcactga

DBGET integrated database retrieval system