KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_0644Help
Entry
AHA_0644          CDS       T00424                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:aha00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    AHA_0644
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AHA_0644
Enzymes [BR:aha01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AHA_0644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
693601..694134
Genome map
AA seq 177 aa AA seqDB search
MKWIMLLLTLGAGAAVAACPDYFNVEMRELNSTQRHNLCQLTEGKVVLVVNTASYCGYRG
QFRDLEQLYQTYKEKGLMVLGFPSNDFWQEAGDEGKTASVCRRDYGVTFPMFNRIAVRGA
DASPLYRGLAAAAGEAPGWNFHKYLIGRDGKLVASYGANQNPADDPLQKEVKRALGL
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggatcatgttgttgctgacactcggggccggggcggccgtcgccgcctgcccg
gactacttcaacgtggagatgcgggagctcaacagcacccagcgccacaacctctgccag
ctgaccgagggcaaggtggtactggtggtcaataccgcctcctactgcggctatcgcggc
cagtttcgggatctggagcagctctatcagacctacaaggagaagggattgatggtgctc
ggcttcccctccaacgacttctggcaggaggcgggggacgagggcaagaccgcctcggtc
tgccgacgcgattacggggtcaccttccccatgttcaaccggatcgccgtgcgcggggcc
gatgccagcccgctttaccgggggttggccgcggcggcgggcgaggcgccgggctggaac
tttcacaaatacctgatcggccgtgacggcaagctggtcgcgagttatggggcgaaccag
aatccggcggacgatcccctgcaaaaagaggtcaaacgggcgctcggcctttag

DBGET integrated database retrieval system