KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_0701Help
Entry
AHA_0701          CDS       T00424                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(748983..749948)
Genome map
AA seq 321 aa AA seqDB search
MIKYQIPTTPDNYTLWYNYVAASMPELNQAIDQAIKLQGTCSLTTCERLYHQHLAAQDEQ
QMETMKLNLAAMANELGHTMQDALSDTGMFQDMLDKSFDRLSLIDDEGLSLEDTMGILRD
LVRESRDVRMSTMHFRNQLSSAEKEIKELREALNETRKLANEDALTSLLNRRAFDLEIES
LIRSKQPFSLILSDIDRFKSFNDEYGHLLGDQVLRAFSKRLRETCKEGVTAYRLGGEEFA
LLVPMRSLALSRQMAESLRRAIEKMSILDRKSGRRIDHITASFGVGEYSGQETGDSLVER
TDKLLYKAKELGRNRVMPLPS
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagtatcaaatccccaccacgccggataattacaccctttggtataactacgtg
gcggccagcatgcccgagctcaatcaggccatcgatcaggccatcaagctgcagggaacc
tgctctctcaccacctgtgaacgcctctatcaccagcacctcgccgcgcaagatgagcag
cagatggaaaccatgaagctcaacctggccgccatggccaacgagcttggtcacaccatg
caggatgccctctccgacaccggcatgtttcaggacatgctcgacaagagcttcgaccgg
ctgagcctcatcgacgacgaggggctcagcctggaagacaccatggggatcctgcgggat
ctggtgcgcgaatcgcgggacgtgcgcatgtccaccatgcactttcgcaaccagctcagc
agcgccgagaaggagatcaaggagctgcgcgaggcgctcaacgagactcgcaagctggcc
aacgaggatgccctcaccagcctgctcaaccggcgcgccttcgatctggagatagagagc
ctgatccgcagcaagcagcccttctccctgatcctgtcggacatagaccgcttcaagagt
ttcaacgatgaatatggccacctgttgggagaccaggtgcttcgcgccttcagcaagcgg
ctgcgggaaacctgcaaggagggcgtcaccgcctaccgcctcggcggcgaggagtttgcc
ctgctggtccccatgcgcagtctggcgctgagccgccaaatggcggagagcctgcgccgg
gccatcgaaaaaatgtcgatcctggatcgcaaatcgggccggcgcatcgaccacatcacc
gcctcgttcggggtgggtgaatacagcggccaggagacgggcgacagcctggtcgaacgc
accgacaagctgctctacaaggccaaggagctgggtcgcaaccgggtgatgccgctgcca
tcctga

DBGET integrated database retrieval system