KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_0701Help
Entry
AHA_0701          CDS       T00424                                 

Definition
(RefSeq) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Brite
Enzymes [BR:aha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     AHA_0701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(748983..749948)
Genome map
AA seq 321 aa AA seqDB search
MIKYQIPTTPDNYTLWYNYVAASMPELNQAIDQAIKLQGTCSLTTCERLYHQHLAAQDEQ
QMETMKLNLAAMANELGHTMQDALSDTGMFQDMLDKSFDRLSLIDDEGLSLEDTMGILRD
LVRESRDVRMSTMHFRNQLSSAEKEIKELREALNETRKLANEDALTSLLNRRAFDLEIES
LIRSKQPFSLILSDIDRFKSFNDEYGHLLGDQVLRAFSKRLRETCKEGVTAYRLGGEEFA
LLVPMRSLALSRQMAESLRRAIEKMSILDRKSGRRIDHITASFGVGEYSGQETGDSLVER
TDKLLYKAKELGRNRVMPLPS
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagtatcaaatccccaccacgccggataattacaccctttggtataactacgtg
gcggccagcatgcccgagctcaatcaggccatcgatcaggccatcaagctgcagggaacc
tgctctctcaccacctgtgaacgcctctatcaccagcacctcgccgcgcaagatgagcag
cagatggaaaccatgaagctcaacctggccgccatggccaacgagcttggtcacaccatg
caggatgccctctccgacaccggcatgtttcaggacatgctcgacaagagcttcgaccgg
ctgagcctcatcgacgacgaggggctcagcctggaagacaccatggggatcctgcgggat
ctggtgcgcgaatcgcgggacgtgcgcatgtccaccatgcactttcgcaaccagctcagc
agcgccgagaaggagatcaaggagctgcgcgaggcgctcaacgagactcgcaagctggcc
aacgaggatgccctcaccagcctgctcaaccggcgcgccttcgatctggagatagagagc
ctgatccgcagcaagcagcccttctccctgatcctgtcggacatagaccgcttcaagagt
ttcaacgatgaatatggccacctgttgggagaccaggtgcttcgcgccttcagcaagcgg
ctgcgggaaacctgcaaggagggcgtcaccgcctaccgcctcggcggcgaggagtttgcc
ctgctggtccccatgcgcagtctggcgctgagccgccaaatggcggagagcctgcgccgg
gccatcgaaaaaatgtcgatcctggatcgcaaatcgggccggcgcatcgaccacatcacc
gcctcgttcggggtgggtgaatacagcggccaggagacgggcgacagcctggtcgaacgc
accgacaagctgctctacaaggccaaggagctgggtcgcaaccgggtgatgccgctgcca
tcctga

DBGET integrated database retrieval system