KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_0827Help
Entry
AHA_0827          CDS       T00424                                 

Gene name
pcm
Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Brite
Enzymes [BR:aha01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     AHA_0827 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
887790..888407
Genome map
AA seq 205 aa AA seqDB search
MIVQRLLNQLIAQDIRDFRVLAAIAKVPRQLFVDEAMAHKAWDNTALPIGHGQTISQPYM
VARMTELLIQNDPAHVLEIGTGSGYQTAVLAHLVEHVYTVERIKSLQFQARRRLRQLDLH
NVSAKHGNGWLGWPNKGPFDAILVTAAASEVPTALTDQLADGGRLVLPVGDSQQTLQLIE
RSGSQLTSRILEPVRFVPLIDGDVE
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtgatagtacagcgcctgttaaaccagctgatcgcgcaggacattcgtgatttccgcgta
ctcgcggcgattgccaaggtgccgcgccagctgttcgtggatgaagccatggcccacaag
gcctgggacaatacggcgttgcccatcggccacggtcaaaccatctcgcaaccctacatg
gtggctcggatgaccgagctgttgatccagaacgatccggcccatgtgctggagatcggc
actggctcgggttaccagacggcggtgctggctcatctggtagagcacgtctatacggtg
gagcggatcaagtcgctgcagttccaggcccggcgccggctgcggcagctcgatctgcac
aatgtctccgccaagcacggcaatggctggttgggttggcccaacaagggccccttcgac
gccattctggtgacggctgccgccagcgaggtgccgacggccctcactgaccagctggcc
gatggtggccggctggtgttgccggtgggggacagccagcagaccctgcagctgatcgag
cggtcgggctcccagctgaccagccggatcctggagccggtccgtttcgtccccctgatt
gacggagatgtcgagtga

DBGET integrated database retrieval system