KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_0917Help
Entry
AHA_0917          CDS       T00424                                 

Definition
polyphosphate glucokinase (EC:2.7.1.63)
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:aha01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:aha00010]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:aha00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(990456..991214)
Genome map
AA seq 252 aa AA seqDB search
MQMLGVDIGGSGIKGCLVDTATGELIGERHRLVTPQPATPAAVAHTLKALVEHFDWKGPV
GCGFPATIHNGIAKSAANIDKSWIETDVAHLFADVTGQPCHVLNDADAAGLAEMRFGTGK
DRSKGVIILVTVGTGIGTAVFVNGQLLPNTELGHLMLEGMVAEHYCSDAVRKREDLSWGR
WGKRFNKYLARLEFLFSPDLFILGGGSAAKLDKFIDKIETRAPLVAAANLNQAGIIGAAL
HAAELTAARQSA
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcagatgttgggagtggatatcggtggctcggggatcaagggatgcctggtcgacacc
gcaacgggcgagctgattggcgaacgtcaccggctggtgacgccgcagccggccaccccg
gccgccgtggctcataccctcaaggcactggtggaacacttcgactggaagggcccggtg
ggctgcggctttcccgccaccatccacaacggcatcgccaagagcgcggccaacatcgac
aagagctggattgagaccgacgtcgcccacctgttcgccgacgtgaccggccaaccctgc
cacgtgctcaacgacgccgatgcggccggcctggcggagatgcgcttcgggaccggcaag
gatcgcagcaagggggtcatcatcctcgtcacggtcggcactggcatcggcaccgccgtg
ttcgtcaacggccagctgctgcccaacaccgagctgggtcatttgatgctggaagggatg
gtggcagagcactactgctcggatgcggtgcgcaaacgcgaggatctctcctggggtcgc
tggggcaagcgcttcaacaagtacctggctcgcctcgagtttctgttctcccccgacctc
ttcatcctgggcggcggcagtgccgccaagctcgacaagttcatcgacaagattgagacc
cgggccccgctggtggcggccgccaacctcaaccaggccggcatcataggcgccgccctg
cacgccgccgagctcaccgccgcccgccagtcggcatga

DBGET integrated database retrieval system