KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_1030Help
Entry
AHA_1030          CDS       T00424                                 

Gene name
cheB-1
Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:aha00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AHA_1030 (cheB-1)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    AHA_1030 (cheB-1)
Enzymes [BR:aha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     AHA_1030 (cheB-1)
Two-component system [BR:aha02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   AHA_1030 (cheB-1)
Bacterial motility proteins [BR:aha02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    AHA_1030 (cheB-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1110170..1111231)
Genome map
AA seq 353 aa AA seqDB search
MKQIKVMLVDDSAVVRQVLQAILEQEPDIKVIATASDPLFALEKLKKEWPDVIVLDVEMP
RMDGITFLTKIMAEHPTPVVICSSLTEKGAETTLQAMAAGAVDIITKPTVGLKSFLQESA
QELAMAVRAAAQANVRRLAKVPAPSVAPKLNADAIMPAASQHAMAQTTERIVAIGTSTGG
TQALEAVLTTLPRVCPGIVIVQHMPEKFTASFAERLNSLCQIEVREAKSNDRVIPGLALI
APGGKHMLLKRSGAYYHVDVMDGPLINRHRPSVDVLFRSVAKFAGGNATGIIMTGMGDDG
ARGLREMLEAGANTFAQDEASCVVFGMPKEAIKLGAARHVLPLQDIHHAIVGR
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagatcaaggtcatgctggtggatgattccgccgtggtcaggcaggtattgcag
gccattctcgagcaggagcccgacatcaaggtcatcgccaccgcgtctgacccgctgttt
gcgctggagaagctgaagaaggagtggccggacgtgatcgtgctggacgtggagatgccg
cgcatggatggcattaccttcctcaccaagatcatggccgaacaccccactcctgtggtc
atctgctcctccctgaccgagaagggggcagaaaccacgctacaggccatggccgccggc
gccgtggatatcatcaccaagcccaccgtcggcctgaaaagctttctgcaggagtcggcg
caggagctggccatggcggtacgcgcagccgcccaggccaatgtcagacgactggccaaa
gtgcccgcccccagcgtcgcccccaagctcaacgccgacgccatcatgcccgccgccagc
cagcatgccatggcccagaccaccgagcggatcgtagcgatcggtacctccaccggcggc
acccaggcgctggaagccgtgttgaccaccctgccccgggtctgccccggcattgtcatc
gtgcagcacatgccggagaagttcaccgcttcgtttgccgagcggctcaacagcctgtgt
cagatagaagtgcgggaggccaagagcaatgacagggtgatccccgggctggcgctgatc
gcccccggcggcaagcacatgctgctcaaacgcagcggcgcctactatcacgtcgacgtg
atggatggccccctcatcaaccgccaccgcccttcggtggacgtgctgtttcgctcggtg
gccaagtttgccggcggcaatgccaccggcatcatcatgaccgggatgggggatgacggt
gcccgcggcttgcgggaaatgctggaggccggcgccaacaccttcgcccaagatgaggcc
tcctgcgtggtcttcggcatgcccaaggaggccatcaagcttggcgccgcccgccatgtc
ttgccgctgcaggatatccatcacgccatcgtgggccgctaa

DBGET integrated database retrieval system