KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_1030Help
Entry
AHA_1030          CDS       T00424                                 

Gene name
cheB-1
Definition
(RefSeq) chemotaxis-specific methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
aha02020  Two-component system
aha02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:aha00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AHA_1030 (cheB-1)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    AHA_1030 (cheB-1)
Enzymes [BR:aha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     AHA_1030 (cheB-1)
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     AHA_1030 (cheB-1)
Two-component system [BR:aha02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   AHA_1030 (cheB-1)
Bacterial motility proteins [BR:aha02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    AHA_1030 (cheB-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg TAL_effector Peptidase_M55
Motif
Other DBs
NCBI-GeneID: 4488794
NCBI-ProteinID: YP_855572
UniProt: A0KH22
Position
complement(1110170..1111231)
Genome map
AA seq 353 aa AA seqDB search
MKQIKVMLVDDSAVVRQVLQAILEQEPDIKVIATASDPLFALEKLKKEWPDVIVLDVEMP
RMDGITFLTKIMAEHPTPVVICSSLTEKGAETTLQAMAAGAVDIITKPTVGLKSFLQESA
QELAMAVRAAAQANVRRLAKVPAPSVAPKLNADAIMPAASQHAMAQTTERIVAIGTSTGG
TQALEAVLTTLPRVCPGIVIVQHMPEKFTASFAERLNSLCQIEVREAKSNDRVIPGLALI
APGGKHMLLKRSGAYYHVDVMDGPLINRHRPSVDVLFRSVAKFAGGNATGIIMTGMGDDG
ARGLREMLEAGANTFAQDEASCVVFGMPKEAIKLGAARHVLPLQDIHHAIVGR
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagatcaaggtcatgctggtggatgattccgccgtggtcaggcaggtattgcag
gccattctcgagcaggagcccgacatcaaggtcatcgccaccgcgtctgacccgctgttt
gcgctggagaagctgaagaaggagtggccggacgtgatcgtgctggacgtggagatgccg
cgcatggatggcattaccttcctcaccaagatcatggccgaacaccccactcctgtggtc
atctgctcctccctgaccgagaagggggcagaaaccacgctacaggccatggccgccggc
gccgtggatatcatcaccaagcccaccgtcggcctgaaaagctttctgcaggagtcggcg
caggagctggccatggcggtacgcgcagccgcccaggccaatgtcagacgactggccaaa
gtgcccgcccccagcgtcgcccccaagctcaacgccgacgccatcatgcccgccgccagc
cagcatgccatggcccagaccaccgagcggatcgtagcgatcggtacctccaccggcggc
acccaggcgctggaagccgtgttgaccaccctgccccgggtctgccccggcattgtcatc
gtgcagcacatgccggagaagttcaccgcttcgtttgccgagcggctcaacagcctgtgt
cagatagaagtgcgggaggccaagagcaatgacagggtgatccccgggctggcgctgatc
gcccccggcggcaagcacatgctgctcaaacgcagcggcgcctactatcacgtcgacgtg
atggatggccccctcatcaaccgccaccgcccttcggtggacgtgctgtttcgctcggtg
gccaagtttgccggcggcaatgccaccggcatcatcatgaccgggatgggggatgacggt
gcccgcggcttgcgggaaatgctggaggccggcgccaacaccttcgcccaagatgaggcc
tcctgcgtggtcttcggcatgcccaaggaggccatcaagcttggcgccgcccgccatgtc
ttgccgctgcaggatatccatcacgccatcgtgggccgctaa

DBGET integrated database retrieval system