KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_1331Help
Entry
AHA_1331          CDS       T00424                                 

Definition
(RefSeq) alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
aha00010  Glycolysis / Gluconeogenesis
aha00071  Fatty acid degradation
aha00350  Tyrosine metabolism
aha00625  Chloroalkane and chloroalkene degradation
aha00626  Naphthalene degradation
aha01100  Metabolic pathways
aha01110  Biosynthesis of secondary metabolites
aha01120  Microbial metabolism in diverse environments
aha01130  Biosynthesis of antibiotics
aha01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AHA_1331
  Lipid metabolism
   00071 Fatty acid degradation
    AHA_1331
  Amino acid metabolism
   00350 Tyrosine metabolism
    AHA_1331
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AHA_1331
   00626 Naphthalene degradation
    AHA_1331
Enzymes [BR:aha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AHA_1331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 CbiC DUF2190 DHQ_synthase
Motif
Other DBs
NCBI-GeneID: 4488461
NCBI-ProteinID: YP_855871
UniProt: A0KHX0
Position
complement(1446709..1447863)
Genome map
AA seq 384 aa AA seqDB search
MSEFLLKPRIRFGQDALSALAEVPARQALLVTDQMMVKVGLADRVTQILRQRGIPFLCWD
DVVADPDITTVVRGMKLMDGCYPDLVIALGGGSVIDAAKAVMFALAQTRPHLGRERPCFV
AIPTTSGTGSEVTSFSVVKARSEKLVLVDPSLLPDIAILDPSLVASVPPAITADTGMDVL
CHALEAYVSRAASDFSDALAEKVVQQVFRYLPACWRDGHDLLAREKMHNASCMAGMAFTN
ASLGITHSLAHALGGVFRVPHGRANALLMAQVVAWNADHDGQCDTQAAHKYARLAHLLDL
PAQTPREGVNSLLVAIQALKDEMKMPAGIGDTGLLAADFDQRLAEMVSQALRDNCTPTNP
RAPDARALTELYRKAWCGTLAAGH
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaatttttgctgaaaccccggatccgcttcggtcaggacgccctgtccgccctg
gccgaagtgcccgcccgccaggcgctgctggtcaccgatcagatgatggtgaaagttggc
ctggccgaccgggtgacgcagatcctgcgccagcgcggcatcccgttcctgtgctgggac
gatgtagtggccgatccggacatcaccacggtcgtgcgcggcatgaagctcatggacggc
tgctatccggatctggtgatcgcgctgggcggcggttcggtgattgatgcagccaaagcg
gtcatgttcgccctggcgcaaacccgcccgcatctggggcgcgagcgcccctgtttcgtg
gccatcccgaccaccagcggcaccggttcggaagtgaccagcttctcggtggtcaaggcc
cgcagcgagaagctggtgctggtcgacccgtcattgctgccggatatcgccattctcgac
ccctcgctggtggcatcggtaccgcccgccattaccgccgacaccgggatggacgtgctg
tgccatgcgctggaggcctatgtctcccgggcggccagcgacttttccgacgcattggcg
gagaaggtggtgcagcaggtctttcgctacctgcccgcctgctggcgcgacggccacgat
ctgctggcgcgggagaagatgcacaacgcctcctgcatggcgggcatggccttcaccaac
gcctcgctcggcatcacccacagcctggcccatgccctcggcggcgtattccgcgtcccg
cacgggcgtgccaacgcgctcctgatggcgcaggtcgtggcatggaacgccgatcatgac
gggcagtgcgatacccaggccgcccacaagtatgcccgcctggcccacctgctggacctg
cccgcccagacgccgcgcgagggggtcaacagcctgctggtggccatccaggcgctcaaa
gacgagatgaagatgcccgccggcattggcgataccggcctcctcgctgccgatttcgac
cagcggctggcggagatggtcagccaggcgctgcgcgacaactgcaccccgaccaacccg
cgcgcaccggatgcccgggcattgaccgaactctatcgcaaggcatggtgcggcactctc
gccgccggccactaa

DBGET integrated database retrieval system