KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_1331Help
Entry
AHA_1331          CDS       T00424                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aha00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    AHA_1331
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AHA_1331
  Lipid metabolism
   00071 Fatty acid degradation
    AHA_1331
  Amino acid metabolism
   00350 Tyrosine metabolism
    AHA_1331
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AHA_1331
   00626 Naphthalene degradation
    AHA_1331
Enzymes [BR:aha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AHA_1331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1446709..1447863)
Genome map
AA seq 384 aa AA seqDB search
MSEFLLKPRIRFGQDALSALAEVPARQALLVTDQMMVKVGLADRVTQILRQRGIPFLCWD
DVVADPDITTVVRGMKLMDGCYPDLVIALGGGSVIDAAKAVMFALAQTRPHLGRERPCFV
AIPTTSGTGSEVTSFSVVKARSEKLVLVDPSLLPDIAILDPSLVASVPPAITADTGMDVL
CHALEAYVSRAASDFSDALAEKVVQQVFRYLPACWRDGHDLLAREKMHNASCMAGMAFTN
ASLGITHSLAHALGGVFRVPHGRANALLMAQVVAWNADHDGQCDTQAAHKYARLAHLLDL
PAQTPREGVNSLLVAIQALKDEMKMPAGIGDTGLLAADFDQRLAEMVSQALRDNCTPTNP
RAPDARALTELYRKAWCGTLAAGH
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaatttttgctgaaaccccggatccgcttcggtcaggacgccctgtccgccctg
gccgaagtgcccgcccgccaggcgctgctggtcaccgatcagatgatggtgaaagttggc
ctggccgaccgggtgacgcagatcctgcgccagcgcggcatcccgttcctgtgctgggac
gatgtagtggccgatccggacatcaccacggtcgtgcgcggcatgaagctcatggacggc
tgctatccggatctggtgatcgcgctgggcggcggttcggtgattgatgcagccaaagcg
gtcatgttcgccctggcgcaaacccgcccgcatctggggcgcgagcgcccctgtttcgtg
gccatcccgaccaccagcggcaccggttcggaagtgaccagcttctcggtggtcaaggcc
cgcagcgagaagctggtgctggtcgacccgtcattgctgccggatatcgccattctcgac
ccctcgctggtggcatcggtaccgcccgccattaccgccgacaccgggatggacgtgctg
tgccatgcgctggaggcctatgtctcccgggcggccagcgacttttccgacgcattggcg
gagaaggtggtgcagcaggtctttcgctacctgcccgcctgctggcgcgacggccacgat
ctgctggcgcgggagaagatgcacaacgcctcctgcatggcgggcatggccttcaccaac
gcctcgctcggcatcacccacagcctggcccatgccctcggcggcgtattccgcgtcccg
cacgggcgtgccaacgcgctcctgatggcgcaggtcgtggcatggaacgccgatcatgac
gggcagtgcgatacccaggccgcccacaagtatgcccgcctggcccacctgctggacctg
cccgcccagacgccgcgcgagggggtcaacagcctgctggtggccatccaggcgctcaaa
gacgagatgaagatgcccgccggcattggcgataccggcctcctcgctgccgatttcgac
cagcggctggcggagatggtcagccaggcgctgcgcgacaactgcaccccgaccaacccg
cgcgcaccggatgcccgggcattgaccgaactctatcgcaaggcatggtgcggcactctc
gccgccggccactaa

DBGET integrated database retrieval system