KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_1351Help
Entry
AHA_1351          CDS       T00424                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:aha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AHA_1351 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AHA_1351 (glk)
   00052 Galactose metabolism
    AHA_1351 (glk)
   00500 Starch and sucrose metabolism
    AHA_1351 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    AHA_1351 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    AHA_1351 (glk)
   00524 Butirosin and neomycin biosynthesis
    AHA_1351 (glk)
Enzymes [BR:aha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     AHA_1351 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1469509..1470477
Genome map
AA seq 322 aa AA seqDB search
MQHTHALVGDVGGTNARLALCELATGTISQAKTYSGLAHPSLEAVVRLYLDEHKVQVGEA
CIAIACPINGDWVAMTNHSWEFSISEMQANLGLSRLQVINDFTAVSMAVPVLDAADCIQL
GGAAPVAGKPIAIYGAGTGLGVAHLVHTGEQWLSLPGEGGHVDFAANSEEEDAVLQVMRA
ELGHVSAERLLSGPGLVNIYRGLVKSDGREPQAFEPKDITERALAGECLDCRRTLSLFCV
LMGRFAGNLALNMGTFGGVYIAGGIVPRFQEFFIGSGFRVAFEDKGRFKSYLKDIPVFLI
THEGPGLLGAGAYLRQSLGIKL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgcagcatacccatgcgctggtcggcgacgtaggcggcaccaatgcccggttggccctg
tgcgagctggcaaccggcaccatttcccaggccaagacctattccgggctggcccatccc
agtctggaagccgtggttcgcctctatctggatgaacacaaggtgcaggtgggcgaagcc
tgcatcgccatcgcctgccccatcaacggcgactgggtcgccatgaccaaccacagctgg
gagttttccatcagcgagatgcaggccaatctgggcctgagccggttgcaggtgatcaac
gattttaccgccgtctccatggcggtgccggtgctggacgcggctgactgcatccagctg
ggaggcgcggcgcccgtggctggcaagcccatcgccatctacggggccggtacaggcctt
ggcgtggcccacctggtgcacaccggcgagcagtggttgagcctgccgggcgagggcggt
cacgtggactttgccgccaacagcgaagaagaggatgcggtgctgcaggtgatgcgcgcc
gagctgggccacgtctcggccgagcggctgctctccggccccggcctcgtcaacatctac
cgtgggctggtgaaatccgacggccgcgagccgcaggcgttcgaacccaaggatatcacc
gagcgcgcgctggcgggcgagtgcctggactgccgccgtaccttgagcctgttctgcgtg
ctgatgggccgctttgccggcaacctggcgctcaacatgggcaccttcggcggcgtctac
atcgccggtggcatagtgccgcgctttcaggagttcttcatcggctcgggctttcgggtg
gccttcgaagacaaggggcgtttcaaatcctacctcaaggatatccccgtcttcctcatc
acccacgaggggccgggtctgctcggcgccggcgcctatctgcgccagtcgctcggcatc
aagctataa

DBGET integrated database retrieval system