KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_1351Help
Entry
AHA_1351          CDS       T00424                                 

Gene name
glk
Definition
(RefSeq) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
aha00010  Glycolysis / Gluconeogenesis
aha00052  Galactose metabolism
aha00500  Starch and sucrose metabolism
aha00520  Amino sugar and nucleotide sugar metabolism
aha00521  Streptomycin biosynthesis
aha01100  Metabolic pathways
aha01110  Biosynthesis of secondary metabolites
aha01120  Microbial metabolism in diverse environments
aha01130  Biosynthesis of antibiotics
aha01200  Carbon metabolism
Module
aha_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
aha_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:aha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AHA_1351 (glk)
   00052 Galactose metabolism
    AHA_1351 (glk)
   00500 Starch and sucrose metabolism
    AHA_1351 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    AHA_1351 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    AHA_1351 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    AHA_1351 (glk)
Enzymes [BR:aha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     AHA_1351 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-GeneID: 4487909
NCBI-ProteinID: YP_855890
UniProt: A0KHY9
Position
1469509..1470477
Genome map
AA seq 322 aa AA seqDB search
MQHTHALVGDVGGTNARLALCELATGTISQAKTYSGLAHPSLEAVVRLYLDEHKVQVGEA
CIAIACPINGDWVAMTNHSWEFSISEMQANLGLSRLQVINDFTAVSMAVPVLDAADCIQL
GGAAPVAGKPIAIYGAGTGLGVAHLVHTGEQWLSLPGEGGHVDFAANSEEEDAVLQVMRA
ELGHVSAERLLSGPGLVNIYRGLVKSDGREPQAFEPKDITERALAGECLDCRRTLSLFCV
LMGRFAGNLALNMGTFGGVYIAGGIVPRFQEFFIGSGFRVAFEDKGRFKSYLKDIPVFLI
THEGPGLLGAGAYLRQSLGIKL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgcagcatacccatgcgctggtcggcgacgtaggcggcaccaatgcccggttggccctg
tgcgagctggcaaccggcaccatttcccaggccaagacctattccgggctggcccatccc
agtctggaagccgtggttcgcctctatctggatgaacacaaggtgcaggtgggcgaagcc
tgcatcgccatcgcctgccccatcaacggcgactgggtcgccatgaccaaccacagctgg
gagttttccatcagcgagatgcaggccaatctgggcctgagccggttgcaggtgatcaac
gattttaccgccgtctccatggcggtgccggtgctggacgcggctgactgcatccagctg
ggaggcgcggcgcccgtggctggcaagcccatcgccatctacggggccggtacaggcctt
ggcgtggcccacctggtgcacaccggcgagcagtggttgagcctgccgggcgagggcggt
cacgtggactttgccgccaacagcgaagaagaggatgcggtgctgcaggtgatgcgcgcc
gagctgggccacgtctcggccgagcggctgctctccggccccggcctcgtcaacatctac
cgtgggctggtgaaatccgacggccgcgagccgcaggcgttcgaacccaaggatatcacc
gagcgcgcgctggcgggcgagtgcctggactgccgccgtaccttgagcctgttctgcgtg
ctgatgggccgctttgccggcaacctggcgctcaacatgggcaccttcggcggcgtctac
atcgccggtggcatagtgccgcgctttcaggagttcttcatcggctcgggctttcgggtg
gccttcgaagacaaggggcgtttcaaatcctacctcaaggatatccccgtcttcctcatc
acccacgaggggccgggtctgctcggcgccggcgcctatctgcgccagtcgctcggcatc
aagctataa

DBGET integrated database retrieval system