KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_1386Help
Entry
AHA_1386          CDS       T00424                                 

Gene name
cheB-2
Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:aha02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:aha02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1521072..1522187
Genome map
AA seq 371 aa AA seqDB search
MAVKVLVVDDSSFFRRRVSEIITQDPMLTVIDTAQNGREAVDKAIQLRPDVITMDIEMPV
MDGISAVREIMAKCPTPILMFSSLTHEGAKATLDALDAGALDFLPKKFEDIARDKDEAVR
LLQQRVKEISRKRFLMAAPARPKAPEPAARSPLSSSIARPAERQAEPPRAMPAAAFKRSG
KSYQLVAIGTSTGGPVALQNVLTKLPGDFPHPILLIQHMPATFTAAFAARLNGLCQIGVK
EAEDGDVLKPGHAYLAPGGKQMLLEGRGAGARIRIVDGNDKVNYKPCVDITFASAAKTYA
DKVLAIVLTGMGADGRDGARLLKEQGSTIWAQDEASCVVYGMPQAVAKAGIATESLPLDR
VAQRILVELGR
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcaaggtattagttgtcgacgattcgagcttcttccgtcgtcgggtcagcgag
atcatcactcaggatcccatgctgacggtgatcgatacggctcaaaatggacgcgaagcc
gtggacaaggcgatccagctgcgcccggatgtgatcaccatggacatcgagatgcccgtg
atggatggcatcagcgccgtacgcgagatcatggccaagtgtccgactccgatcctgatg
ttctcctctttgactcatgaaggggccaaggcgacgctggatgcgctggatgccggggcg
ctcgatttcctgcccaagaaatttgaagatatcgcccgtgacaaggatgaagccgttcgc
ctgttgcagcagcgagtcaaggagatttctcgcaagcgtttcctgatggcggcacctgct
cgtcccaaagcccctgaacctgccgcccgttccccgctgagcagctcaatcgcccggcca
gcagagcgtcaggccgagccgccgcgagctatgcctgcggcagccttcaaacgcagtggc
aagagttatcagctggtggctatcggtacctcgacggggggcccggttgcgctgcagaac
gtgttgaccaaattacccggtgattttcctcatcccatcttgttgatccagcatatgccg
gcaacctttaccgctgcgtttgccgctcgcctcaacggtctgtgccagatcggggtcaag
gaagcggaagatggtgatgtgctcaaacctggtcatgcttacctggctccgggcggcaag
cagatgctgctggaagggcgtggtgcgggtgcccgtatccggattgtcgatggcaatgac
aaggtgaattacaaaccgtgcgtcgacatcacctttgcctctgccgccaaaacctatgcc
gacaaggtgctcgccatcgtgttgaccgggatgggggcagatggtcgggatggtgcgcgt
ctgctcaaggagcagggctctaccatctgggcacaggatgaagcttcctgcgtggtatat
ggcatgccgcaagcggttgccaaagccggcatcgccacggaatcactgccgctggatcgg
gtagcacaacgaatcctggttgagctgggccgctaa

DBGET integrated database retrieval system