KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_1604Help
Entry
AHA_1604          CDS       T00424                                 

Gene name
fhs
Definition
formate--tetrahydrofolate ligase (EC:6.3.4.3)
Orthology
K01938  
formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
One carbon pool by folate
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
C1-unit interconversion, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:aha01200]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:aha00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1751175..1752905)
Genome map
AA seq 576 aa AA seqDB search
MLSDIEISRQSPRLPIHALAERLAIPSHQLHPYGHYKGKLSLELLKSLPKPAGKLVLVSA
ITPTPLGEGKTVTTLGLSMGLNHIGQPSIATIRQPSLGPVFGVKGGAAGGGHAQVVPMEE
MNLHLTGDFHALTAAHNLAAAALDARLFHERKLGDQFSARTGLQRLDIDADNILWPRTLD
MNDRALRHLTIGQGNAADGVERSDRFVITAASELMAILALASDLKDLRQRIGRIQLARDL
RGKPITAEQLEVAGAMTVLLKEALQPTLMQTTEQTSVLVHAGPFANIAHGNSSVIADRMA
LGLTDYVVTEAGFGSDMGLEKFFNIKHRQSGITPACVVLVATVRGLKANSGLLDIRPGQP
LPESLLREDLPTLEQGCANLGWHIANARRYGVPVVVAINRFPTDSEAELALLARAALRAG
ACGSAISSAFTQGGAGASELAQAVVAACEQPGKVKLLYPDQASLGAKLATLVECGYGGRG
VQLSDKARQQLAQLSAEGWDHLPVCVAKTPLSISHDPALKGVPTDFEVPIEEVKLCAGAG
FVYALAGPIMTMPGLGSLPAYRHIDIDDNGEIVGLS
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgctaagcgatatcgagatctcccgccagtccccccgtctccccattcacgcgctggcc
gaacgcctcgccatcccttcgcaccagctccatccttacggtcactacaagggcaaactc
agcctcgagctactcaagtctctccccaaaccggcgggcaagctggtgctggtgagcgcc
atcacccccaccccgcttggcgagggcaagacggtgaccaccctcggcctctccatgggg
ctcaaccatatcggccagcccagcatcgccaccatccgccagccgagcctgggcccggtg
ttcggggtcaaggggggcgccgccggtggtggtcacgcccaggtggtgccgatggaggag
atgaacctgcacctcaccggcgattttcacgctctcaccgccgcccacaacctggcggcg
gcggccctcgatgcccgcctgttccatgaacgcaagctcggcgaccagttcagcgccaga
accggtttgcagcggctcgatatcgatgcagacaacatcctctggccgcgcaccctcgac
atgaacgaccgcgccctgcgccacctcacgattggacaggggaacgccgccgacggggtg
gagcgcagcgatcgctttgtcatcaccgccgcctccgagctgatggccattctggcgctg
gcgagcgatctgaaagatctgcgccagcgcatcggccgcatccagctggcccgcgacctg
cgcggcaagcccatcaccgccgagcagctggaagtggcgggcgccatgacggtgctactc
aaagaagccctgcagccgaccctgatgcagaccaccgagcagacctcggtgctggtgcac
gccggcccctttgccaacatcgcccacggcaactcctcggtgatcgccgatcgcatggcc
ctcggcctcaccgattacgtggtgacagaggcgggctttggctccgacatggggctggag
aagttcttcaacatcaagcaccgccagtccggtatcacgccggcctgcgtggtgctggtg
gcgacggtgcgcggcctcaaggccaacagcggactgctcgacattagaccgggtcagccg
ctgccggaaagcctgctgcgcgaggatctgccgactctcgagcagggctgcgccaacctc
ggctggcacatcgccaatgcccgccgctacggggtgccggtggtggtggccatcaaccgc
ttccccaccgacagcgaggccgagctggccctgctggcccgcgcggcgctgcgagccggc
gcttgtggcagcgccatctccagcgcctttactcagggtggagccggtgccagcgagctg
gcccaggcggtggtggccgcctgtgagcagccaggcaaggtcaaactgctctaccccgac
caggcgagcctgggcgccaagctggcgaccctggtggagtgcggttatggcgggcgcggc
gtgcagctttccgataaagcgcgccagcagctggcacaactctctgccgaggggtgggat
cacttgccggtctgtgtggccaagacgccgctctccatcagccatgaccccgccctcaag
ggggtgccgacggacttcgaggtgcccatcgaggaggtgaagctgtgcgccggtgccggt
ttcgtctatgccctggcaggccccatcatgaccatgccgggccttggcagcctgccggcc
taccgtcatatcgacatcgatgataacggcgaaattgtcggcctgagctga

DBGET integrated database retrieval system