KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_1604Help
Entry
AHA_1604          CDS       T00424                                 

Gene name
fhs
Definition
formate--tetrahydrofolate ligase (EC:6.3.4.3)
Orthology
K01938  
formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
One carbon pool by folate
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:aha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AHA_1604 (fhs)
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    AHA_1604 (fhs)
Enzymes [BR:aha01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     AHA_1604 (fhs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1751175..1752905)
Genome map
AA seq 576 aa AA seqDB search
MLSDIEISRQSPRLPIHALAERLAIPSHQLHPYGHYKGKLSLELLKSLPKPAGKLVLVSA
ITPTPLGEGKTVTTLGLSMGLNHIGQPSIATIRQPSLGPVFGVKGGAAGGGHAQVVPMEE
MNLHLTGDFHALTAAHNLAAAALDARLFHERKLGDQFSARTGLQRLDIDADNILWPRTLD
MNDRALRHLTIGQGNAADGVERSDRFVITAASELMAILALASDLKDLRQRIGRIQLARDL
RGKPITAEQLEVAGAMTVLLKEALQPTLMQTTEQTSVLVHAGPFANIAHGNSSVIADRMA
LGLTDYVVTEAGFGSDMGLEKFFNIKHRQSGITPACVVLVATVRGLKANSGLLDIRPGQP
LPESLLREDLPTLEQGCANLGWHIANARRYGVPVVVAINRFPTDSEAELALLARAALRAG
ACGSAISSAFTQGGAGASELAQAVVAACEQPGKVKLLYPDQASLGAKLATLVECGYGGRG
VQLSDKARQQLAQLSAEGWDHLPVCVAKTPLSISHDPALKGVPTDFEVPIEEVKLCAGAG
FVYALAGPIMTMPGLGSLPAYRHIDIDDNGEIVGLS
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgctaagcgatatcgagatctcccgccagtccccccgtctccccattcacgcgctggcc
gaacgcctcgccatcccttcgcaccagctccatccttacggtcactacaagggcaaactc
agcctcgagctactcaagtctctccccaaaccggcgggcaagctggtgctggtgagcgcc
atcacccccaccccgcttggcgagggcaagacggtgaccaccctcggcctctccatgggg
ctcaaccatatcggccagcccagcatcgccaccatccgccagccgagcctgggcccggtg
ttcggggtcaaggggggcgccgccggtggtggtcacgcccaggtggtgccgatggaggag
atgaacctgcacctcaccggcgattttcacgctctcaccgccgcccacaacctggcggcg
gcggccctcgatgcccgcctgttccatgaacgcaagctcggcgaccagttcagcgccaga
accggtttgcagcggctcgatatcgatgcagacaacatcctctggccgcgcaccctcgac
atgaacgaccgcgccctgcgccacctcacgattggacaggggaacgccgccgacggggtg
gagcgcagcgatcgctttgtcatcaccgccgcctccgagctgatggccattctggcgctg
gcgagcgatctgaaagatctgcgccagcgcatcggccgcatccagctggcccgcgacctg
cgcggcaagcccatcaccgccgagcagctggaagtggcgggcgccatgacggtgctactc
aaagaagccctgcagccgaccctgatgcagaccaccgagcagacctcggtgctggtgcac
gccggcccctttgccaacatcgcccacggcaactcctcggtgatcgccgatcgcatggcc
ctcggcctcaccgattacgtggtgacagaggcgggctttggctccgacatggggctggag
aagttcttcaacatcaagcaccgccagtccggtatcacgccggcctgcgtggtgctggtg
gcgacggtgcgcggcctcaaggccaacagcggactgctcgacattagaccgggtcagccg
ctgccggaaagcctgctgcgcgaggatctgccgactctcgagcagggctgcgccaacctc
ggctggcacatcgccaatgcccgccgctacggggtgccggtggtggtggccatcaaccgc
ttccccaccgacagcgaggccgagctggccctgctggcccgcgcggcgctgcgagccggc
gcttgtggcagcgccatctccagcgcctttactcagggtggagccggtgccagcgagctg
gcccaggcggtggtggccgcctgtgagcagccaggcaaggtcaaactgctctaccccgac
caggcgagcctgggcgccaagctggcgaccctggtggagtgcggttatggcgggcgcggc
gtgcagctttccgataaagcgcgccagcagctggcacaactctctgccgaggggtgggat
cacttgccggtctgtgtggccaagacgccgctctccatcagccatgaccccgccctcaag
ggggtgccgacggacttcgaggtgcccatcgaggaggtgaagctgtgcgccggtgccggt
ttcgtctatgccctggcaggccccatcatgaccatgccgggccttggcagcctgccggcc
taccgtcatatcgacatcgatgataacggcgaaattgtcggcctgagctga

DBGET integrated database retrieval system