KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_1807Help
Entry
AHA_1807          CDS       T00424                                 

Gene name
ribA
Definition
(RefSeq) GTP cyclohydrolase II
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
aha00740  Riboflavin metabolism
aha00790  Folate biosynthesis
aha01100  Metabolic pathways
aha01110  Biosynthesis of secondary metabolites
aha02024  Quorum sensing
Module
aha_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:aha00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    AHA_1807 (ribA)
   00790 Folate biosynthesis
    AHA_1807 (ribA)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    AHA_1807 (ribA)
Enzymes [BR:aha01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     AHA_1807 (ribA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2
Motif
Other DBs
NCBI-GeneID: 4487840
NCBI-ProteinID: YP_856342
UniProt: A0KJ91
Position
complement(1974152..1974745)
Genome map
AA seq 197 aa AA seqDB search
MSSVTLVAKSKLPTPWGTFTLVGFQETGTGKDHAALVMGDITGDEPVLGRIHSECLTGDA
LFSLRCDCGFQLQAALENIAKAGRGVLLYVRQEGRGIGLLNKIRAYHLQDQGADTVEANV
ALGFAADMRDYTICADMLKQLEVKSLKLMTNNPRKMKAMESFGIPVAERVPLQEGRNPHN
EFYLSTKANKLDHMFKK
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcgttaccctcgtggccaaatccaagttgccgaccccctggggcactttcacg
ctggtaggctttcaggaaaccggtaccggcaaggatcacgccgcactggtgatgggcgat
atcacgggtgatgagccggtgctgggccgcattcactccgagtgcctgaccggcgatgcc
ctgttcagtctgcgttgcgactgtggcttccagctgcaggctgcattggaaaacatcgcc
aaggcaggccgtggcgtcttgctgtacgtgcgtcaggaagggcgcggcatcggcctgctc
aacaagatccgggcctatcatctgcaggatcagggcgccgacaccgtcgaggccaacgtg
gcgctcggctttgccgccgacatgcgcgactacaccatctgcgccgacatgctcaagcag
ctggaggtgaaatccctcaagttgatgaccaacaacccgcgcaagatgaaggcgatggaa
tccttcggtattcctgtagcggagcgggtgcccctgcaggaagggcgcaatccccacaac
gagttctacctctcgaccaaggccaacaagctggatcacatgtttaagaagtga

DBGET integrated database retrieval system