KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_1897Help
Entry
AHA_1897          CDS       T00424                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:aha00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AHA_1897
  Lipid metabolism
   00561 Glycerolipid metabolism
    AHA_1897
   00600 Sphingolipid metabolism
    AHA_1897
Enzymes [BR:aha01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     AHA_1897
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2070167..2071876
Genome map
AA seq 569 aa AA seqDB search
MTSLLSRLRQLADDHHLPPSLLQTRQWEGPLCRVRLDNTGGSEARVGHWTLFDGKLGLSP
ACAIYGEGFQMLAQTMGSWQAPQPVGRCPDAGVYRITDDQGCHTVHNLLLVEHDKGWLLL
AFASCQRFGGEFRLYPDGRLQILMNGEGRALPAGQFWQSEALLCLEGKDREALLAELAQR
IEAEHGSLIGQVGERPSGWCSWYHYYADVSAADIRENLQVRAERFPALRYVQIDDGYQAK
MGDWLTPSAKFEQGVASLAAEIKGAGCEPALWVAPFIAEPGSQVFQDHPDWFVKGDDGLP
LPSERVTYGGWRCTPWYVLDGTHPEVQAHLERVFRTLREQWGIHYFKLDANFWGAIHGGR
FHDPAATRVEAYRRGMAAILRGAGEGAFLLGCNAPIWPSLGLVHGMRVSDDVERNGHRYR
QIAREAFCRAWQNDRLWALDPDCICLRDLPSQQASPAEYRFHLAALVASGGMMLAGDRLQ
DLDEVQAAQLRKLLELCAARAPGARFESMDFACGEVSLPGGGTLLCLFNWEAQPQEFLLP
AGGEDFWDEGAVGTALTLQGGEGRVIRYR
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgacatctctcttgtcccgcctgcgccagctggcggacgaccaccatctgcccccttcg
ttgctgcaaacccgccagtgggaggggcccctgtgccgggtgcggctcgacaacaccggc
ggcagcgaggcccgggtcgggcactggacgctgtttgacggcaagctcggtctctcgccc
gcgtgcgccatctacggcgaaggcttccagatgctggcccagaccatgggcagctggcaa
gcgccgcagccggtcggccgttgccccgatgccggtgtctatcgcatcaccgatgatcag
ggttgtcacacggtacacaacctgctgctggtggagcatgacaagggctggttgctgctc
gcctttgccagttgtcagcgctttggcggggagtttcggctctaccccgatggccggctg
cagatcctgatgaatggtgaggggcgtgcactccctgccggccagttctggcagagcgag
gcgctgctctgcctcgaagggaaagatcgtgaggcgctgctggccgaactggcgcagcgg
atcgaggccgagcatggctcgctgatcggccaggttggcgaacgccccagcggctggtgc
tcctggtatcactactacgcggacgtgagcgccgccgacattcgcgagaacctgcaggtg
cgtgccgagcgtttcccggcgctgcgctacgtgcagattgacgacggctatcaagccaag
atgggcgactggctcaccccgtcggccaagttcgagcagggggtggcctccctggctgcc
gagatcaaaggcgccggctgcgagccggcgctctgggtggccccctttatcgccgagccc
ggctcccaggtgtttcaggatcaccccgactggttcgtgaagggggatgacgggctgccg
ctgccctccgagcgggttacctacggcggttggcgctgtaccccctggtatgtgctggat
ggcacccaccccgaggtacaggctcacctcgagcgggtgtttcgtaccctgcgcgagcag
tggggcatccactacttcaagctcgacgccaacttctggggggccatccacggcggccgc
ttccacgacccggccgccacccgggtggaggcctaccgacgcggcatggccgccatcctg
cgcggagcgggcgagggggccttcctgctcggctgcaacgcccccatctggccaagcctc
ggcctggtgcatggtatgcgggtgagcgatgacgtggagcgcaatggccatcgctatcgc
cagatcgctcgcgaggccttctgccgcgcctggcagaacgaccgactgtgggccctcgat
cctgactgcatctgcctgcgggatctgccgagccagcaggcgagccctgccgagtaccgc
tttcatctggcggcgctggtggcaagcggcggcatgatgctggccggggacaggctgcag
gatctcgacgaggtgcaggcggcgcaactgcgcaagctgctcgagctttgcgcggcgcgc
gcccctggcgcccgtttcgagtcgatggattttgcctgcggcgaggtgagcctgcccggg
ggcggcaccctgctctgcctcttcaactgggaggcgcagcctcaggagttcctgttgccg
gcaggcggcgaagatttctgggatgagggggccgtcggtaccgcgctcaccctgcagggg
ggcgaggggcgggtgatccgctaccgctga

DBGET integrated database retrieval system