KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_1897Help
Entry
AHA_1897          CDS       T00424                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:aha00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:aha00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:aha00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2070167..2071876
Genome map
AA seq 569 aa AA seqDB search
MTSLLSRLRQLADDHHLPPSLLQTRQWEGPLCRVRLDNTGGSEARVGHWTLFDGKLGLSP
ACAIYGEGFQMLAQTMGSWQAPQPVGRCPDAGVYRITDDQGCHTVHNLLLVEHDKGWLLL
AFASCQRFGGEFRLYPDGRLQILMNGEGRALPAGQFWQSEALLCLEGKDREALLAELAQR
IEAEHGSLIGQVGERPSGWCSWYHYYADVSAADIRENLQVRAERFPALRYVQIDDGYQAK
MGDWLTPSAKFEQGVASLAAEIKGAGCEPALWVAPFIAEPGSQVFQDHPDWFVKGDDGLP
LPSERVTYGGWRCTPWYVLDGTHPEVQAHLERVFRTLREQWGIHYFKLDANFWGAIHGGR
FHDPAATRVEAYRRGMAAILRGAGEGAFLLGCNAPIWPSLGLVHGMRVSDDVERNGHRYR
QIAREAFCRAWQNDRLWALDPDCICLRDLPSQQASPAEYRFHLAALVASGGMMLAGDRLQ
DLDEVQAAQLRKLLELCAARAPGARFESMDFACGEVSLPGGGTLLCLFNWEAQPQEFLLP
AGGEDFWDEGAVGTALTLQGGEGRVIRYR
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgacatctctcttgtcccgcctgcgccagctggcggacgaccaccatctgcccccttcg
ttgctgcaaacccgccagtgggaggggcccctgtgccgggtgcggctcgacaacaccggc
ggcagcgaggcccgggtcgggcactggacgctgtttgacggcaagctcggtctctcgccc
gcgtgcgccatctacggcgaaggcttccagatgctggcccagaccatgggcagctggcaa
gcgccgcagccggtcggccgttgccccgatgccggtgtctatcgcatcaccgatgatcag
ggttgtcacacggtacacaacctgctgctggtggagcatgacaagggctggttgctgctc
gcctttgccagttgtcagcgctttggcggggagtttcggctctaccccgatggccggctg
cagatcctgatgaatggtgaggggcgtgcactccctgccggccagttctggcagagcgag
gcgctgctctgcctcgaagggaaagatcgtgaggcgctgctggccgaactggcgcagcgg
atcgaggccgagcatggctcgctgatcggccaggttggcgaacgccccagcggctggtgc
tcctggtatcactactacgcggacgtgagcgccgccgacattcgcgagaacctgcaggtg
cgtgccgagcgtttcccggcgctgcgctacgtgcagattgacgacggctatcaagccaag
atgggcgactggctcaccccgtcggccaagttcgagcagggggtggcctccctggctgcc
gagatcaaaggcgccggctgcgagccggcgctctgggtggccccctttatcgccgagccc
ggctcccaggtgtttcaggatcaccccgactggttcgtgaagggggatgacgggctgccg
ctgccctccgagcgggttacctacggcggttggcgctgtaccccctggtatgtgctggat
ggcacccaccccgaggtacaggctcacctcgagcgggtgtttcgtaccctgcgcgagcag
tggggcatccactacttcaagctcgacgccaacttctggggggccatccacggcggccgc
ttccacgacccggccgccacccgggtggaggcctaccgacgcggcatggccgccatcctg
cgcggagcgggcgagggggccttcctgctcggctgcaacgcccccatctggccaagcctc
ggcctggtgcatggtatgcgggtgagcgatgacgtggagcgcaatggccatcgctatcgc
cagatcgctcgcgaggccttctgccgcgcctggcagaacgaccgactgtgggccctcgat
cctgactgcatctgcctgcgggatctgccgagccagcaggcgagccctgccgagtaccgc
tttcatctggcggcgctggtggcaagcggcggcatgatgctggccggggacaggctgcag
gatctcgacgaggtgcaggcggcgcaactgcgcaagctgctcgagctttgcgcggcgcgc
gcccctggcgcccgtttcgagtcgatggattttgcctgcggcgaggtgagcctgcccggg
ggcggcaccctgctctgcctcttcaactgggaggcgcagcctcaggagttcctgttgccg
gcaggcggcgaagatttctgggatgagggggccgtcggtaccgcgctcaccctgcagggg
ggcgaggggcgggtgatccgctaccgctga

DBGET integrated database retrieval system