KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_1924Help
Entry
AHA_1924          CDS       T00424                                 

Definition
(RefSeq) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
aha00020  Citrate cycle (TCA cycle)
aha00190  Oxidative phosphorylation
aha00650  Butanoate metabolism
aha01100  Metabolic pathways
aha01110  Biosynthesis of secondary metabolites
aha01120  Microbial metabolism in diverse environments
aha01130  Biosynthesis of antibiotics
aha01200  Carbon metabolism
Module
aha_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aha_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
aha_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:aha00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AHA_1924
   00650 Butanoate metabolism
    AHA_1924
  Energy metabolism
   00190 Oxidative phosphorylation
    AHA_1924
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-GeneID: 4488638
NCBI-ProteinID: YP_856455
UniProt: A0KJK4
Position
2100256..2100600
Genome map
AA seq 114 aa AA seqDB search
MVTNSATFGRSGVHDYILIRATALIMTCYVLYLVGFVAFNDISYEVWTGFFAKTFTKVFT
LLALLCVLIHAWIGLWQVLTDYIKPVGLRGALQFALVVVLFVYLMTGFVVLWGV
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccaattctgcaaccttcgggcgcagcggcgttcacgattacatcctgatccgc
gccaccgccctcatcatgacctgttatgtcctctacctggtgggctttgtcgcgttcaac
gacatcagctacgaggtgtggaccggcttcttcgccaaaaccttcaccaaggtgttcacc
ctgttggcgctgctgtgcgtactgatccacgcctggatcggtctgtggcaggtgctgacc
gactatatcaagccggtggggttgcgcggtgcgctgcaatttgccctggtagtggtgctg
ttcgtctacctgatgaccggcttcgttgtactgtggggggtgtaa

DBGET integrated database retrieval system