KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_1928Help
Entry
AHA_1928          CDS       T00424                                 

Gene name
sucB
Definition
(RefSeq) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
aha00020  Citrate cycle (TCA cycle)
aha00310  Lysine degradation
aha01100  Metabolic pathways
aha01110  Biosynthesis of secondary metabolites
aha01120  Microbial metabolism in diverse environments
aha01130  Biosynthesis of antibiotics
aha01200  Carbon metabolism
Module
aha_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aha_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aha00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AHA_1928 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    AHA_1928 (sucB)
Enzymes [BR:aha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     AHA_1928 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding HTH_17
Motif
Other DBs
NCBI-GeneID: 4488642
NCBI-ProteinID: YP_856459
UniProt: A0KJK8
Position
2106127..2107314
Genome map
AA seq 395 aa AA seqDB search
MTIEIKVPDLPESVADATIATWHKKPGDLVARDEVLVDIETDKVVLEVPAPEAGVLGDIL
QSEGATVLSRQLIAMLKPAPVAGEETKEKPVEAVADDAADGLSPSVRRLVAEHDIDVAKL
TGTGKGGRVTKEDVEAFIKGGNKPAAAPVAAAAPAAPVAPLAGRTEKRVPMTRLRKRIAE
RLLEAKNTTAMLTTFNEINMAPIMKLRKQYGEIFEKKHGIKLGFMSFYVKAVVESLKRYP
EVNAALDGDDIVYHNYFDVSIAVSTPRGLVTPVLRDCDNMSLADIEKAIKDLAGKGRDGK
LTVDELTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHKIQDRPMAVDGKVEILPMMYL
ALSYDHRIIDGRESVGFLVSIKELLEDPTRLLLDV
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgactatcgagatcaaagtaccggacctgccggaatcagtggcggatgccaccatcgcc
acctggcacaagaaaccgggtgatctggttgcccgtgatgaagtgctggtcgacatcgag
accgacaaggtcgtgctggaagtgccggcgccggaagccggcgtgctgggcgacatcctg
caaagcgaaggggccaccgtgctctcccgccagctgatcgccatgctcaagcctgccccg
gtggccggcgaagagaccaaggagaagccggtcgaagcggtggccgatgacgctgccgat
ggcctgagcccctccgtgcgccgcctggtggccgagcatgacatcgacgtcgccaagctg
accggtactggcaagggcggtcgcgtcaccaaggaagacgtggaagccttcatcaagggt
ggcaacaagcctgccgccgccccggttgccgctgcagccccggctgcgccggtcgctccg
ctggccggtcgcaccgaaaagcgcgtgcccatgacccgtctgcgcaagcgcatcgccgag
cgtctgctggaggccaagaacaccaccgccatgctgaccaccttcaacgagatcaacatg
gcgcccatcatgaagctgcgcaagcagtacggcgagatcttcgagaagaagcacggcatc
aagctcggcttcatgtccttctacgtgaaggcggtggtggaatccctcaagcgctacccg
gaagtgaacgcggcgctggacggtgacgacatcgtctaccacaactacttcgacgtcagc
atcgccgtctccaccccccgtggtctggtgaccccggtgctgcgtgactgcgacaacatg
agcctggccgacatcgagaaggccatcaaagacctggccggcaagggccgtgacggcaag
ctgaccgtggatgaactgaccggcggcaacttcaccatcaccaacggtggcgtgttcggc
tccctgatgtccaccccgatcatcaacccgccccagagcgccattctgggcatgcacaag
atccaggaccgcccgatggccgtcgacggcaaggtcgagatcctgccgatgatgtacctg
gcgctctcctacgatcaccgcatcatcgacggccgcgagtcggtgggcttcctggtctcc
atcaaggagctgctggaagatccgacccgtctgctgctggacgtctaa

DBGET integrated database retrieval system