KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_2050Help
Entry
AHA_2050          CDS       T00424                                 

Definition
phage lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Brite
Enzymes [BR:aha01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     AHA_2050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2253952..2254443
Genome map
AA seq 163 aa AA seqDB search
MNKVRIAIAALTLSAAGFVGILNREGFEPTAYPDPVHGARLPTIGFGSTEGVKMGDTITP
VAAVNRSLREVRIFEDALKACIKVPLHQYEFDAYVELSHNIGPGAFCRSTIVKRLNAGDY
PGACEAILLFKRAGNQDCSAPGNRVCPGLWKDRLRLNAKCKGE
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaggtccgcattgcaatcgcggccctcacgctaagtgctgcgggctttgtgggg
atcctgaatcgggaggggtttgagccgacggcttaccccgacccggtacacggtgccagg
cttcccacaatcggctttgggagcaccgaaggggtcaagatgggtgacaccatcacgccc
gtcgccgcggtgaacagaagccttcgggaggtgcggatattcgaggatgccctcaaggcc
tgcatcaaggtgcctctccaccagtatgagttcgatgcctatgtcgagctctcccacaac
atcggccctggggccttttgccgttccaccatcgtgaagcgcctgaacgccggcgattac
cccggggcctgcgaggcgatcctgctgttcaagcgggctggcaatcaagactgttcggcg
ccggggaaccgggtgtgccccgggctttggaaagatcgactgcgcctcaatgcgaagtgc
aagggggagtga

DBGET integrated database retrieval system