KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_2091Help
Entry
AHA_2091          CDS       T00424                                 

Definition
beta-glucosidase (EC:3.2.1.21)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:aha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AHA_2091
Enzymes [BR:aha01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     AHA_2091
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2302339..2303772
Genome map
AA seq 477 aa AA seqDB search
MHHHKFNDFPADFLWGAASAAYQVEGAWNADGKGPSVWDLFTKLPGKTFEGSNGDVAVDH
YHRMEEDVALMAEMGLKAYRFSVSWPRIYPTGRGEVNEAGLAFYEKLIDTLLAHQIEPVL
TLYHWDLPQVLQDEYGGWEDRRIIEDFEHYCVTLYQRFAGKVKYWVSLNEQNYNLTNAYQ
LGTHPPAVQDRKRFFAANHIAFLANAQVIKAFRQHVPGGLIGPSFAYSPAYPASCDPKDM
LAFENAEEFTNLWWLDAYCFGRYPQAALAYLRETGEAPDILPGDLELLREGTPDYIGVNY
YYTLTFTDNPLGGQTLQRINTTGQKGTTPSSGIPGLYKTAPNPHLETSNWDWAIDPTGMR
IALRRLSSRYGLPLMITENGLGEFDKLAEGDRVHDDYRIDYLRSHVKACQEALQDGVELL
GYCAWSFTDILSWLNGYQKRYGFVFVERDEQGGSLRRLKKDSFYWYQTVISSGGKTL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaccacaagttcaacgacttccccgccgattttctgtggggcgccgcctccgct
gcctaccaggtggaaggggcctggaacgccgatggcaagggcccctcggtgtgggatctg
ttcaccaagttgccgggcaagacctttgagggcagcaacggcgacgtggcggtggatcac
taccaccgcatggaggaggatgtggcgctgatggcggaaatggggctcaaggcctaccgc
ttctcggtgagctggccgcgcatctatcccaccggccgcggcgaggtgaacgaggcgggg
ctggccttctacgagaaactcatcgataccctgctggcgcatcagatagagccggtgctc
accctttatcattgggatctgccccaggtgctgcaggatgaatacggcggctgggaagac
cgacgcatcatcgaagatttcgagcactactgcgtgaccttgtatcagcgctttgccggc
aaggtgaagtactgggtgtcgctcaacgagcagaactacaacctgaccaacgcctatcag
ctcggcacgcacccgcccgcagtgcaggatcgcaagcgcttctttgccgccaaccacatc
gcgttcctggccaacgcccaggtcatcaaggcgttccgccagcacgtgccgggggggctg
atcggccctagctttgcctactcgcccgcctatccggcgtcgtgcgaccccaaagacatg
ctggcgtttgaaaacgccgaggagttcaccaacctctggtggctggatgcctactgcttt
ggccgttatccgcaggcggcgcttgcctacctgcgggagaccggcgaggcgccggatatc
ctgcccggcgatctcgagctgttgcgggaagggacgcccgactacatcggggtcaactac
tactacaccctgaccttcaccgacaacccgctcggcggccagaccctgcagcgtatcaac
accacggggcagaagggtaccactccctcgagcggcattcccggcctctacaagacggcc
cccaacccgcaccttgagaccagcaactgggactgggccatcgacccgaccgggatgcgc
atcgccctgcgccggctctcctcccgctacggtctgccgctgatgatcaccgagaacggc
ctcggcgagttcgacaagctggcagagggagatcgggtgcacgacgactaccgcatcgac
tatctgcgcagccacgtcaaggcgtgccaggaggcgctgcaggacggggtggaactgctg
ggctattgcgcctggtcgttcaccgacatcctgagctggctcaacggctaccagaagcgc
tacggcttcgtctttgtggagcgtgacgaacagggcggctccctgcgccggctcaagaag
gacagcttctactggtaccagacggtaataagctcgggcggcaaaacgctctag

DBGET integrated database retrieval system