KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_2195Help
Entry
AHA_2195          CDS       T00424                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:aha00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AHA_2195 (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    AHA_2195 (hisD)
Enzymes [BR:aha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     AHA_2195 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2421010..2422335)
Genome map
AA seq 441 aa AA seqDB search
MQTLIWKTLSPAQQADVLTRPALSDEADIGAVVREIIAAVRSRGDEALRELSQRFERVPR
QQLQVSDAEIEAACARLGDDIKGAIEAAIANIRSFHAAQVQPVVRVETQPGVVCELRTQP
ISRVGLYVPGGSAPLPSTVMMLAIPAAIAGCREVVLCTPSPASDEILFAARACGVEKVFA
IGGAQAIAAMAYGTQSIPKVDKIFGPGNAYVTEAKGQVSRDWRGAAIDMPAGPSEVLVIA
DESANPAFVAADLLSQAEHGPDSQVVLVTTSPLLADAINGEIKRQLAKLTRRDIAAQALG
SSLVILCDDLAEACAISNAYAPEHLIVQTRAPRDLLDQLENAGSIFLGAWTPESVGDYAS
GTNHTLPTYGYARTCSSLGLADYQRRYTVQELSERGIQGLGPIVERIAQAEGLDGHKNAV
TLRLNALAAAPQQTAQQKDLS
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccctgatctggaagaccctctcccccgcccagcaggccgacgtgctgacccgg
ccggccctgagtgacgaggccgacatcggcgccgtggtgcgggagatcatcgctgcggtg
cgcagccggggcgacgaggctctgcgcgagctgagccagcgcttcgagcgcgtcccccgt
cagcaactgcaggtgagcgatgccgaaatcgaggccgcctgcgcccgcttgggtgacgat
attaagggcgccatcgaggcggcgattgccaacattcgttcctttcacgccgcccaggta
cagccggtggtgcgggtggagacccagcccggggtagtgtgcgagctgcgcacccagccc
atcagccgggtcggtctctacgtgccagggggcagcgcgccgctcccctccaccgtgatg
atgctggccattccagctgctatcgccggttgccgtgaagtggtgctctgcaccccgtcc
ccggccagcgacgagatcctgttcgccgctcgcgcctgcggcgtcgagaaggtgttcgcc
atcggcggcgcccaggccatcgcggccatggcttacggcacacagagcatccccaaggtg
gacaagatcttcggcccgggcaacgcctatgtgaccgaagccaagggccaggtatcccgt
gactggcgcggcgccgccatcgacatgcccgctggcccctccgaggtgctggtgattgcc
gacgagagcgccaacccggccttcgtggcggcggatctgctctcccaggccgagcacggc
cccgacagtcaggtggtgctggtgaccacctcgccgctgctggccgatgctatcaacggc
gagatcaagcgccaactggccaagctgactcgccgcgatatcgccgcgcaggcgctcggc
agcagtctggtgatcctctgcgacgatctggcagaagcctgcgccatctccaacgcctac
gcgccggagcacctgatcgtgcagacccgcgctccccgtgatctactggatcagcttgag
aatgccggctccatcttcctgggagcatggacgccggaatcggtcggcgattacgccagc
ggtaccaaccacaccctgcccacctacggttatgcccgcacctgctcgagcctgggcctc
gccgattaccagcgccgctacacggtgcaggagctgagcgaacgcggcattcagggcctt
ggtcccatcgtcgagcgcatcgcccaggccgaggggctcgatggccacaagaacgccgtc
accctcaggttgaacgccctggccgccgcgccccaacaaacagcacagcagaaggatttg
tcatga

DBGET integrated database retrieval system