KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_2313Help
Entry
AHA_2313          CDS       T00424                                 

Gene name
rbsK
Definition
(RefSeq) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
aha00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:aha00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AHA_2313 (rbsK)
Enzymes [BR:aha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     AHA_2313 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase
Motif
Other DBs
NCBI-GeneID: 4487770
NCBI-ProteinID: YP_856836
UniProt: A0KKN5
Position
2555577..2556509
Genome map
AA seq 310 aa AA seqDB search
MNRLVVLGSVNADHVLRVPHFPRPGETLTGHSYQVVPGGKGANQAVAAARLGAEVSFIAR
IGDDAIGHQMKTGFAKDGIDVSAVELDPKLPTGIAIIYVSDEGENSIGISAEANGALTPA
VVKSHQTMIAAAHTLLLQLEVPLESVQEAARLARAHGTRVVLNPAPARPLSSELLALVDL
ITPNQTEAELLTGVKVTDEASAAEAAARFHQMGIGEVMITLGSQGVYCSKGQQQALIPGF
RVKAVDTTAAGDTFNGALLAAELAGADFDAAVRFAHGAAALSVTRFGAQSSIPSKQEVDA
FLLEQTAQGH
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtctcgtcgttctgggcagtgtcaatgcagaccacgtgctgcgcgttccccac
tttcctcgcccgggtgaaaccctgaccggccacagctatcaagttgtacccggtggcaag
ggcgccaaccaggcggtggccgccgctcggttaggtgctgaagtctcctttatcgcccgc
atcggcgatgacgccatcggccaccagatgaagaccggttttgccaaagacggtatcgac
gtgagcgccgtcgagctcgaccccaaactcccgaccggcattgccatcatttatgtgagc
gatgagggggagaacagcatcggcatctccgccgaagccaacggcgccctcaccccggcc
gtagtgaaaagccaccagacgatgatcgccgccgcccacaccctgctgctgcagctggaa
gtgccgctggagagcgtgcaggaagccgcccggctggcccgagcccacggcacccgggtg
gtgctcaaccccgcccccgctcgcccgctctcaagcgaactgctggcactggtcgacctc
atcacccccaaccagactgaagccgagctgttgaccggcgtcaaggtcaccgacgaggcg
agcgcagccgaggcggctgcccgcttccaccagatgggtatcggggaggtgatgatcacc
ctgggctcgcaaggagtctattgcagcaaggggcagcaacaagcgctcatcccgggtttt
cgggtgaaagcagtggacaccactgccgcgggcgataccttcaacggcgccctgctggcg
gccgagctcgccggcgccgactttgacgcggccgtgcgctttgcccacggcgccgcggcg
ctctccgtcacccggtttggtgcccagagctccatcccgagcaagcaggaggtcgacgcc
ttcctgcttgagcagactgcgcaggggcactga

DBGET integrated database retrieval system