KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_2383Help
Entry
AHA_2383          CDS       T00424                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:aha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AHA_2383 (pfkA)
   01230 Biosynthesis of amino acids
    AHA_2383 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AHA_2383 (pfkA)
   00030 Pentose phosphate pathway
    AHA_2383 (pfkA)
   00051 Fructose and mannose metabolism
    AHA_2383 (pfkA)
   00052 Galactose metabolism
    AHA_2383 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    AHA_2383 (pfkA)
Enzymes [BR:aha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AHA_2383 (pfkA)
Protein phosphatases and associated proteins [BR:aha01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AHA_2383 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2633314..2634285
Genome map
AA seq 323 aa AA seqDB search
MTKQIKRIGVLTSGGDAPGMNAAIRAVVRAGLHHGLEVYGIYDGYLGLHQDRIVKLERHS
VSDVVNRGGTFLGSARFPAFKDPKVRAEAIENLKKHGIDALVVIGGDGSYMGAKKLTEEG
FPCIGLPGTIDNDIAGTDFTIGFDTALNVVVDAIDRLRDTCSSHHRISVVEIMGRHCGDL
AMSAAVAGGAEYVIVPEVAFDKDKLLQQIKEGEAKGKKHAIITICEHVTDVNALAKDIEA
LTGRETRATILGHIQRGGTPTARDRIMSSRMGAYAVEQLLAGHGGRCVGIQRNEMVHHDI
IDCIENLKRPFDQELYDLSTTLF
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaacaaatcaaacgtattggtgttttgaccagtggtggtgacgcaccgggtatg
aacgcagccatccgcgccgtggtgcgcgccggtctgcatcatggcctggaagtctacggc
atctatgatggctacctcggtctgcaccaggaccgtatcgtcaagctggagcgtcacagc
gtctccgacgtggtcaaccgtggtggtaccttccttggctccgcccgtttccccgccttc
aaagatccgaaagtgcgcgccgaagcgatcgaaaatctgaaaaagcacggcatcgacgcc
ctggtggtgatcggtggtgacggttcctacatgggtgccaagaagctgaccgaagagggt
ttcccctgcatcggcctgccgggcaccatcgacaacgacatcgccggtaccgacttcacc
atcggctttgataccgcgctgaacgtggtggtagacgccatcgaccgtctgcgcgatacc
tgcagctcccaccaccgcatctccgtggtcgagatcatgggccgtcactgcggcgatctg
gccatgtccgccgccgttgctggcggtgccgagtacgtgatcgtgccggaagtggcgttc
gacaaggacaagctgctgcaacagatcaaggaaggcgaagccaagggcaagaagcacgcc
atcatcaccatctgtgagcacgtcaccgacgtgaacgccctggccaaggacatcgaagcc
ctgaccggccgcgaaacccgtgccaccatcctgggccacatccagcgtggcggaaccccc
accgcgcgtgaccgcatcatgtccagccgtatgggcgcctacgccgtcgagcagctgctg
gccggtcacggtggccgctgtgtcggcatccagcgcaacgagatggtgcaccacgacatc
atcgactgcatcgagaacctcaagcgcccgttcgatcaggagctctacgatctctccacc
accctgttctaa

DBGET integrated database retrieval system