KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_2491Help
Entry
AHA_2491          CDS       T00424                                 

Gene name
recR
Definition
(RefSeq) recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:aha00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    AHA_2491 (recR)
DNA repair and recombination proteins [BR:aha03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      AHA_2491 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2770954..2771556)
Genome map
AA seq 200 aa AA seqDB search
MKFSPLLDEMMKALQVLPGVGPKSAQRMAFTLLERERSGGLRLAQLLSRALTEIGHCSHC
RTFTENERCEICANPKREENGLLCVVESPADVAAIEQTGQFSGRYFVLMGHLSPLDGIGP
EELGLEILERRLKDEAISELILATNPTIEGDATAWYIADMARAAGVKVSRIAHGVPVGGE
LELVDGTTLSHSLMGRQPLN
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcagcccgctgctggatgagatgatgaaagccctgcaggtgctgccgggtgtc
ggccccaagtcggcccagcgcatggcatttaccctgctcgagcgtgagcgcagcggcggc
ctgcggctggcccagctgctctctcgcgccctcaccgagattggtcactgcagccactgc
cgtaccttcaccgagaatgagcgctgcgagatttgcgccaatcccaagcgcgaagagaac
ggcctgctgtgcgtggtggagagcccggcggacgtggccgccatcgagcagaccggccag
ttctccggccgctacttcgtgctaatgggtcacctctcgccgctggacggcattggcccc
gaggagctggggctggagatcctggagcgacggttgaaagacgaggcgatcagcgagctt
attctggccaccaaccccaccatcgaaggggacgccaccgcctggtacatcgccgacatg
gcccgcgccgctggcgtcaaggtgagccggattgcccacggtgtgccggtgggtggcgag
ctggagctggtggacggcaccacgctctcccactctctgatggggcgtcagccccttaat
tga

DBGET integrated database retrieval system