KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_2657Help
Entry
AHA_2657          CDS       T00424                                 

Gene name
asnB
Definition
asparagine synthetase B (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:aha00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2963618..2965282
Genome map
AA seq 554 aa AA seqDB search
MCSIFGILDIKSDAAALRKSALEMSKRLRHRGPDWSGVYSSDKAILVHERLAIVDPGNGA
QPLYNPERTHVLAVNGEIYNHKELEKSLKVDFQFQTHSDCEVLLALYKEKGPAFLDDLNG
IFAFILYDAEQDAYLIGRDHMGIIPLYTGRDEHGNFYVASEMKALVPVCKSVETFPPGHY
LWSKDGELKQWYKRDWMEYDAVEHNVSDKAELKAALEAAVKRQLMCDVPYGVLLSGGLDS
SVISAITKLYAARRVEDDGKSEAWWPQLHSFAVGLEGSPDLAAARKVADHLGTIHHQIHF
TVQEGLDALRDVIYHLETYDVTTIRASTPMYLMARYIKAMGIKMVLSGEGSDELFGGYLY
FHKAPNAREFHEENVRKLASLHLYDCLRANKSMAAWGVEGRVPFLDKEFMDVAMRLQPAD
KMCGKGKIEKHILREAFEDLLPHEVAWRQKEQFSDGVGYSWIDSLKAMVEEEVTDQMFEA
AAFRFPVNTPLTKEAYFYRAIFDEHFPLESAARTVPYGKSVACSTPTALEWDAKFKEMAD
PSGRAVMDVHQQGY
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgttctattttcggcattctggacatcaaatccgatgcggccgcgctgcgcaaatcg
gcgctggagatgtccaagcgattgcgccaccgcggtcctgactggtccggcgtctacagc
tccgacaaagccattctggtgcacgagcgcctggctatcgtcgatccgggcaacggcgcc
cagccgctctacaaccccgagcgcacccacgtgctggccgtcaacggcgagatctacaac
cacaaggagctggagaagagcctcaaggtcgacttccagttccagacccactccgactgc
gaggtgctgctggccctctacaaggagaagggcccggcgtttctggacgatctcaacggc
atcttcgcctttatcctctatgacgcggagcaggatgcctacctgattggtcgcgaccac
atggggatcatccccctctataccggccgcgacgagcacggcaacttctacgtcgcctcc
gagatgaaggcgctggtaccggtctgcaagagcgtcgaaaccttcccgccgggacactac
ctgtggagcaaggatggagagctcaaacagtggtacaaacgcgactggatggagtatgac
gcggtcgagcacaacgtcagtgacaaggccgagctgaaagccgcgctggaagcggcggtc
aagcgccagctgatgtgcgacgtgccctatggcgtgctgctctccggcgggctggattcg
tccgtcatctccgccatcaccaagctctatgccgcccgtcgggttgaagatgatggcaag
agcgaagcctggtggccccagctgcactccttcgccgtcggcctggaaggctcgccggat
ctcgccgccgcccgcaaggtggccgatcacctcggcaccatccaccaccagatccacttc
accgtgcaggagggactggatgccctgcgggacgtcatctatcacctcgagacctatgac
gtcaccaccatccgcgcctccacgcccatgtatctgatggcccgctacatcaaggcgatg
gggatcaaaatggtgctctccggcgaaggctccgacgagttgttcggtggctacctctac
ttccacaaggcgcccaacgcccgcgagttccacgaagagaacgtgcgcaagctcgcctcg
ctgcatctctatgactgcctgcgcgccaacaagtcgatggccgcctggggggtggagggt
cgcgtgcccttcctcgacaaggagttcatggacgtggcgatgcgcctgcagcctgccgac
aagatgtgcggcaagggcaagatcgaaaagcacatcctgcgcgaagcattcgaggatctg
ctgccccacgaagtggcatggcgccagaaggagcagttctccgatggcgtgggctattcg
tggatcgacagcctcaaagccatggtcgaggaagaggtgacggatcagatgttcgaggcg
gcggccttccgcttccccgtcaacaccccgctcaccaaggaggcctacttctaccgcgcc
atctttgacgagcacttcccgctggagtccgccgcccgtaccgtgccctacggcaagtcg
gtcgcctgctccaccccgaccgcgctggagtgggatgccaagttcaaagagatggccgac
ccgtccggtcgcgccgtgatggacgtccaccagcagggttactga

DBGET integrated database retrieval system