KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_2722Help
Entry
AHA_2722          CDS       T00424                                 

Gene name
leuA-2
Definition
2-isopropylmalate synthase (EC:2.3.3.13)
Orthology
K01649  
2-isopropylmalate synthase [EC:2.3.3.13]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
Valine, leucine and isoleucine biosynthesis
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:aha00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    AHA_2722 (leuA-2)
   01230 Biosynthesis of amino acids
    AHA_2722 (leuA-2)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AHA_2722 (leuA-2)
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    AHA_2722 (leuA-2)
Enzymes [BR:aha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.13  2-isopropylmalate synthase
     AHA_2722 (leuA-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3058555..3060213)
Genome map
AA seq 552 aa AA seqDB search
MSFDHRKYRRAPVINLADRQWPNRVLERAPLWCAVDLRDGNQALVEPMTVAQKLQMWALM
VHIGFKHIEVGFPAASQPDFDFVRELIDRNLIPDDVTIQVLVQAREDLIARTFEALKGAK
RAIVHVYNSVNPTQRNYVFNSGREGVKAIAVQGARWVREYAARNSGTEWSFQYSPESFSC
TEVEFAVEVCDAVIDQWRPAARPMILNLPATVEVSTPNVFADQVEWFCRHLKARPEVSIS
IHTHNDRGCGVAAAELAVLAGADRIEGTLLGNGERTGNMDIVTMAMNLYSQGIDPELNLA
DMDAIVATVGACTQIALHPRHPYAGELVYTAFSGSHQDAIRKSLAAEKPDHYWDVAYLPI
DPADLGRSYEAVIRINSQSGKGGVTYLLERDLGLQLPRWLQIDFSRRVQAEAEASSSEIS
PEQIRSLFERHYLEPAHGYRIGRFQLGRDSQESLRLELQTPTGSLQLSGEGEGAITALVN
GWQRQTGMHIDVLDYSEHALSAGTESRAAAYVLLSVDGTRTCGVAIGRDVVSASLQAVIN
GAAQIEALRQSA
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcgatcatcgcaaataccgccgtgcccccgtcatcaatctggcggatcgccag
tggcccaaccgggtgctggagcgggcgccgctctggtgcgccgtggatctgcgcgacggc
aaccaggcgctggtcgagccgatgacggtggcgcagaagctgcagatgtgggcgctgatg
gtgcacatcggcttcaagcacatcgaggtgggctttccggccgcctctcagcccgatttt
gacttcgtgcgcgagcttatcgatcgcaatctcattccggacgacgtcaccatccaggtg
ttggtacaggcgcgcgaagatctgatagcccgcaccttcgaggccctcaagggggccaag
cgggccatcgtccacgtctacaactcggtcaacccgacccagcgcaactatgtgttcaac
tcagggcgcgaaggggtcaaggccatcgccgtgcagggggcgcgttgggtgcgggagtat
gcggcccgcaattcgggcaccgagtggagttttcagtactcgccggagagtttcagctgc
accgaggtggagttcgccgtcgaggtgtgtgacgcggtgatcgaccagtggcgcccggcg
gcccgcccgatgatcctgaacctgcccgccaccgtggaggtgagcacccccaacgtgttt
gccgatcaggtggagtggttctgccgccacctcaaggcgcgccccgaggtgagtatctcc
atccatacccacaacgatcggggctgcggggtggccgccgccgagttggcggtgttggcg
ggggcggatcgcatcgagggcaccctgctcggcaacggtgagcgcaccggcaacatggac
atcgtcaccatggccatgaacctctacagccaggggatcgaccccgagctcaacctggcg
gacatggatgccatcgtcgccaccgtgggagcctgcacccagattgccctgcacccgcgc
cacccctatgccggcgagctggtctacacggcgttttccggcagccaccaggacgccatc
cgcaaatccctggcggcggagaagccggatcactactgggacgtggcttacctgcccatc
gatcctgccgatctcggtcgcagctacgaggcggtgatccgcatcaacagccagtccggc
aaggggggcgttacctacctgctggagcgcgatcttggtctgcaactgccgcgttggctg
caaattgacttcagccgccgggtacaagccgaggctgaggcgagcagcagcgagataagt
ccggagcagatccgctccctgttcgagcgtcactatctcgaacccgcccacggctatcgc
atcggtcgcttccagctcggtcgcgacagccaggagagcctgcgcctcgaactgcagacc
ccgaccggctcgctgcagttgagcggtgaaggggagggggccatcacggcgctggtcaac
ggctggcagcgtcagaccgggatgcacatcgacgtgctggattactccgagcatgcctta
agcgccggcaccgagtcccgcgccgccgcctacgtgctgctgagtgtcgacgggacccgc
acctgcggggtggccatcggccgcgatgtggtcagcgcctccctgcaggcggtgatcaat
ggcgccgcccagatagaggcgctgcgccagagcgcctga

DBGET integrated database retrieval system