KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_2722Help
Entry
AHA_2722          CDS       T00424                                 

Gene name
leuA-2
Definition
2-isopropylmalate synthase (EC:2.3.3.13)
Orthology
K01649  
2-isopropylmalate synthase [EC:2.3.3.13]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
Valine, leucine and isoleucine biosynthesis
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:aha01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:aha01230]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:aha00620]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine biosynthesis [PATH:aha00290]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(3058555..3060213)
Genome map
AA seq 552 aa AA seqDB search
MSFDHRKYRRAPVINLADRQWPNRVLERAPLWCAVDLRDGNQALVEPMTVAQKLQMWALM
VHIGFKHIEVGFPAASQPDFDFVRELIDRNLIPDDVTIQVLVQAREDLIARTFEALKGAK
RAIVHVYNSVNPTQRNYVFNSGREGVKAIAVQGARWVREYAARNSGTEWSFQYSPESFSC
TEVEFAVEVCDAVIDQWRPAARPMILNLPATVEVSTPNVFADQVEWFCRHLKARPEVSIS
IHTHNDRGCGVAAAELAVLAGADRIEGTLLGNGERTGNMDIVTMAMNLYSQGIDPELNLA
DMDAIVATVGACTQIALHPRHPYAGELVYTAFSGSHQDAIRKSLAAEKPDHYWDVAYLPI
DPADLGRSYEAVIRINSQSGKGGVTYLLERDLGLQLPRWLQIDFSRRVQAEAEASSSEIS
PEQIRSLFERHYLEPAHGYRIGRFQLGRDSQESLRLELQTPTGSLQLSGEGEGAITALVN
GWQRQTGMHIDVLDYSEHALSAGTESRAAAYVLLSVDGTRTCGVAIGRDVVSASLQAVIN
GAAQIEALRQSA
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcgatcatcgcaaataccgccgtgcccccgtcatcaatctggcggatcgccag
tggcccaaccgggtgctggagcgggcgccgctctggtgcgccgtggatctgcgcgacggc
aaccaggcgctggtcgagccgatgacggtggcgcagaagctgcagatgtgggcgctgatg
gtgcacatcggcttcaagcacatcgaggtgggctttccggccgcctctcagcccgatttt
gacttcgtgcgcgagcttatcgatcgcaatctcattccggacgacgtcaccatccaggtg
ttggtacaggcgcgcgaagatctgatagcccgcaccttcgaggccctcaagggggccaag
cgggccatcgtccacgtctacaactcggtcaacccgacccagcgcaactatgtgttcaac
tcagggcgcgaaggggtcaaggccatcgccgtgcagggggcgcgttgggtgcgggagtat
gcggcccgcaattcgggcaccgagtggagttttcagtactcgccggagagtttcagctgc
accgaggtggagttcgccgtcgaggtgtgtgacgcggtgatcgaccagtggcgcccggcg
gcccgcccgatgatcctgaacctgcccgccaccgtggaggtgagcacccccaacgtgttt
gccgatcaggtggagtggttctgccgccacctcaaggcgcgccccgaggtgagtatctcc
atccatacccacaacgatcggggctgcggggtggccgccgccgagttggcggtgttggcg
ggggcggatcgcatcgagggcaccctgctcggcaacggtgagcgcaccggcaacatggac
atcgtcaccatggccatgaacctctacagccaggggatcgaccccgagctcaacctggcg
gacatggatgccatcgtcgccaccgtgggagcctgcacccagattgccctgcacccgcgc
cacccctatgccggcgagctggtctacacggcgttttccggcagccaccaggacgccatc
cgcaaatccctggcggcggagaagccggatcactactgggacgtggcttacctgcccatc
gatcctgccgatctcggtcgcagctacgaggcggtgatccgcatcaacagccagtccggc
aaggggggcgttacctacctgctggagcgcgatcttggtctgcaactgccgcgttggctg
caaattgacttcagccgccgggtacaagccgaggctgaggcgagcagcagcgagataagt
ccggagcagatccgctccctgttcgagcgtcactatctcgaacccgcccacggctatcgc
atcggtcgcttccagctcggtcgcgacagccaggagagcctgcgcctcgaactgcagacc
ccgaccggctcgctgcagttgagcggtgaaggggagggggccatcacggcgctggtcaac
ggctggcagcgtcagaccgggatgcacatcgacgtgctggattactccgagcatgcctta
agcgccggcaccgagtcccgcgccgccgcctacgtgctgctgagtgtcgacgggacccgc
acctgcggggtggccatcggccgcgatgtggtcagcgcctccctgcaggcggtgatcaat
ggcgccgcccagatagaggcgctgcgccagagcgcctga

DBGET integrated database retrieval system