KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_2791Help
Entry
AHA_2791          CDS       T00424                                 

Definition
alkaline phosphatase, placental type (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:aha00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AHA_2791
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    AHA_2791
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AHA_2791
Enzymes [BR:aha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     AHA_2791
Exosome [BR:aha04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AHA_2791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
3135268..3136659
Genome map
AA seq 463 aa AA seqDB search
MRKMAGLALMIGAALAAGCNSNNDSSAPAPGAKNVIFFLGDGMGLNTLTAARIYGVGEEG
SLTIDTLPETAFIKTFSHDAQVTDSAPSMSAYMTGVKSNNGVISMDSDATQESNCSKSAG
KPVTTLLELAKAAGRGTGVVTTTRVTHATPAATYAHLCNRDLEADIAAQLVPGGAGYNSA
LKEGVDVVLGGGSSFFLPKADKGKREDGRNLIDEMKAKGYQFAGNLDELNKAEAGKPLLG
LFGSSHMKYDLDRPASEPSLTQMTLAAIKQLKDQKQGYFLMVEGGRIDHALHDTNAKRAL
QDTLAFDNAIKATLDEVKKTDPELKNTLIVVTADHDHTLVLNGYAKRTGKTTADNPGVLG
LVKNYETGEPSKDADGMPYTIIGFGNGYNRVDGPRSSVAPLDDATVSANDYHQEVVVKVG
EIGNETHGGTDVFLGAIGQGADSFHGSLDNTAVFGKVKAAAGL
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagatggcaggacttgcattgatgatcggcgccgccctggctgccggctgcaac
tccaacaacgacagcagtgcgcccgcccccggcgccaagaacgtgatcttcttcctcggc
gacggcatgggtctcaataccctgaccgccgcccgcatctacggcgtcggtgaagagggc
agcctcaccatcgataccctgccggagacggccttcatcaagaccttctcccacgacgcc
caggtgaccgactcggccccctccatgtccgcctacatgaccggggtcaagagcaacaac
ggcgtcatcagcatggacagcgacgccacccaggagagcaactgcagcaagagcgccggc
aagccggtcaccaccttgctggagctggccaaggccgccggccgcggcaccggcgtggtc
accaccacccgggtgactcacgccaccccggccgccacctatgcccacctctgcaaccgg
gatctggaagccgacatcgccgcccagctggtgcccggcggcgccggttacaacagcgcc
ctcaaagagggggtggacgtggtgctcggcggcggcagcagcttcttcctgccgaaggca
gacaaaggcaagcgcgaggatggccgcaacctcatcgatgaaatgaaggccaagggctac
cagtttgccggcaatctggacgagttgaacaaggccgaggcgggcaagccgctgctgggg
ctgtttggctcaagccacatgaaatatgacctggaccggcccgccagcgagccttccctc
acccagatgaccctggctgccatcaagcagctcaaagaccagaagcagggctacttcctg
atggtggaagggggccgcatcgaccacgccctgcacgacaccaacgccaagcgtgccctg
caggacaccctcgccttcgacaacgccatcaaggcaactctcgacgaggtgaagaaaacc
gatcccgagctgaaaaacaccctgatcgtggtcaccgccgaccatgaccacacgctagtc
ctgaatggttatgccaagcgtaccggcaagaccaccgccgacaaccccggcgtgctcggg
ctggtgaagaactacgaaaccggtgaaccgagcaaggatgccgatggcatgccctacacc
atcatcggctttggcaacggctacaaccgggtggacgggccgcgcagcagcgtggcgccg
ctggacgacgccaccgtctccgccaacgactatcaccaggaggtggtggtcaaggtgggc
gaaatcggcaacgagacccacggcggcaccgacgtcttcctcggcgccatcggccaggga
gcggatagcttccacggctcactcgacaacaccgccgtgttcggcaaggtcaaggctgcg
gccgggctgtaa

DBGET integrated database retrieval system