KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_2816Help
Entry
AHA_2816          CDS       T00424                                 

Gene name
aceB
Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:aha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AHA_2816 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AHA_2816 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    AHA_2816 (aceB)
Enzymes [BR:aha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     AHA_2816 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
3163381..3164988
Genome map
AA seq 535 aa AA seqDB search
MSAPAQTHCSARLRIQGETHPDYAQILTPDAVALVSELVERFAPQRDELLKQRVARQARI
DGGELPDFLPETAHIRAGDWTVRGIPADLQDRRVEITGPVERKMVINALNANVKVFMADF
EDSLAPAWNKVIEGQINLRDAVNGTVSYTSPEGKAYTLNADPAVLICRVRGLHLPEKHVT
FDGAPIPGGLFDFALYFLHNYQALLAKGSGPYFYVPKLQSHLEGRWWSEVFAWTEDKFGL
PRGTIKATVLIETLPAVFEMDELLYQMKDHIVALNCGRWDYIFSYIKTLKNHPDRVLPDR
QVVTMDKPFLSAYSRLLIKTCHKRGALAMGGMAAFIPAKDPAVNEQVFAKVKADKEREAN
NGHDGTWVAHPGLADTAMAVFNAAIPAGASNQIGVLREQDAPITAAELLAPCEGERTEAG
MRTNIRVALQYLEAWINGNGCVPIYGLMEDAATAEISRTSIWQWIRHGKSLSNGKVVTKD
LFRQMLAEEQEVVKAEVGAERWQAGRFAEASELMEQITCADTLIDFLTLPGYERL
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcaccggcccagacccactgcagcgctcgtctgcgcatccagggcgagacgcat
cccgattacgcgcaaattctgacgccggatgcggtggccctggtatccgaactggtggaa
cgctttgctccccaacgggacgaattgttgaaacaacgtgtggcgcgccaggcccgcatc
gacggcggcgagctgcccgattttctgcctgaaaccgcccacatccgcgccggagactgg
acggtgcgcggcattcccgccgacctgcaagatcgccgcgtggagatcaccggcccggtc
gagcgcaagatggtgatcaacgccctcaacgccaacgtcaaggtgttcatggcggacttc
gaggattcgctggcaccggcctggaacaaggtgatcgagggtcagatcaacctgcgcgat
gcggtcaacggcaccgtctcctacaccagcccggaagggaaggcttataccctgaacgcc
gatccggccgtgcttatctgccgggtgcgcggtctgcatctgccggaaaaacatgtcacc
ttcgatggcgcccccattcccggcggcctgttcgacttcgctctctacttcctgcacaac
tatcaggcactgctggccaagggctctggcccctacttctacgtacccaagctgcagagc
catctggaagggcgctggtggagcgaagtgttcgcctggaccgaggacaaattcggcctg
ccccgcggcaccatcaaggccaccgtgctcatcgaaaccctgccagcggtgttcgagatg
gacgagctgctctatcagatgaaggatcacatcgtcgccctcaactgcggccgctgggat
tacatcttcagctacatcaaaactttgaagaaccaccctgatcgcgtcctgccggaccgc
caggtcgtgaccatggacaaaccgttcctgtccgcctattcgcggctgctgatcaagacc
tgccacaagcgcggcgcgctggcgatgggtggcatggcggcctttatcccggcgaaagat
cctgccgtgaatgaacaggtatttgccaaggtgaaggctgataaagagcgtgaagccaac
aacggccacgacggtacctgggtggcccaccccggtctcgccgataccgccatggcggtg
ttcaacgccgccatcccggctggtgccagcaaccagatcggcgtgctgcgcgagcaggat
gctcccatcacggccgccgagctgctggccccctgcgagggcgagcgcaccgaggcaggc
atgcgcaccaacatccgggtggcgctgcaatacctggaagcctggatcaacggcaacggc
tgcgtgcccatctacggtctgatggaagacgccgccaccgccgagatctcccgcacctcc
atctggcagtggatccgccacggcaagagcctgtcgaacggcaaggtggtgaccaaggat
ctgttccgccagatgctggccgaggagcaggaggtggtcaaagccgaagtgggggccgag
cgctggcaggcaggccgcttcgccgaggcgagcgagctgatggaacagatcacctgcgcc
gatactctgatcgattttctgacgctgcccggttacgagcggctctga

DBGET integrated database retrieval system