KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_2817Help
Entry
AHA_2817          CDS       T00424                                 

Gene name
aceA
Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:aha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AHA_2817 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AHA_2817 (aceA)
Enzymes [BR:aha01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     AHA_2817 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
3165064..3166377
Genome map
AA seq 437 aa AA seqDB search
MALTREQQIQAIEKDWAENPRWKGIKRGYSAEDVVNLRGSLQPVHTLAQRGADKLWELIH
GGAKKGYVNCLGALTGGQAVQQAKAGIEAIYLSGWQVAADNNLSSTMYPDQSLYPANSVP
SVVERINNSFARADQIQWANKVGPQDKGFIDYFLPIVADAEAGFGGVLNAFELMKGMIEA
GAAGVHFEDQLASVKKCGHMGGKVLVPSQEAVQKLIAARLAADVCGTTTLVIARTDANAA
DLLTTDADPYDAGFLTGERTSEGFYKVQAGIEQAISRGLAYAPYADMVWCETAKPDLDEA
RKFAEAIKAQYPDKILAYNCSPSFNWKKNLDDATIARFQQELSDMGYKYQFITLAGIHNM
WFHMYELAYQYARGEGMKHYVEMVQQPEFAAAERGYTFVAHQQEVGTGYFDKVTTVIQGG
QSSVTALTGSTEEDQFH
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggcactgacccgtgagcaacagatccaggctatcgagaaagactgggcggaaaacccc
cgctggaaagggatcaagcgcggctacagcgccgaagacgtggtaaacctgcgtggcagc
ctgcaaccggtgcacaccctggcccagcgcggtgccgacaagctgtgggaactgatccac
ggcggcgccaagaaaggctatgtaaactgcctcggcgcgctgactggcggtcaggcggtg
caacaggccaaggcgggcatcgaggcaatttacctctccggctggcaggtggcggcggac
aacaacctctcctccaccatgtacccggatcagtccctctacccggccaactcggtgccg
tcggtggtggagcgcatcaacaactccttcgcccgtgccgaccagatccagtgggccaac
aaggtgggcccgcaggacaagggcttcatcgactacttcctgcctatcgtggcggatgcc
gaagccggtttcggcggcgtgctgaacgcctttgagctgatgaaggggatgattgaagcg
ggcgccgccggcgtgcacttcgaagatcagctcgcctccgtcaagaagtgcggccacatg
ggcggcaaggtgctggtgccgagccaggaagcggtgcagaagttgatcgcggcccgtctg
gcagccgacgtctgcggcaccaccaccctggtgatcgcccgtaccgacgccaacgccgcc
gacctgctgaccacggatgccgatccgtacgatgctggcttcctgaccggtgagcgcacc
tcagaaggcttctacaaggtgcaggccggtatcgaacaggccatctcccgcggtctggcg
tatgccccttacgccgacatggtgtggtgcgaaaccgccaagccggatctggacgaggcg
cgcaagtttgccgaagccatcaaggcccagtacccggacaagatcctggcctacaactgc
tcgccgagtttcaactggaagaaaaacctggacgatgccaccatcgcccgcttccagcag
gagctgtccgacatgggctacaagtaccagttcatcaccctggcgggcatccacaacatg
tggttccacatgtacgagctggcctaccagtacgcccgtggcgaggggatgaagcactat
gtcgaaatggtgcagcagccggaattcgccgctgccgagcgcggttacaccttcgtggca
caccagcaggaagtgggtaccggttacttcgacaaggtcaccaccgtcattcagggcggc
caatcctcggtgaccgccctgaccggctcgaccgaagaagatcagttccactga

DBGET integrated database retrieval system