KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_2817Help
Entry
AHA_2817          CDS       T00424                                 

Gene name
aceA
Definition
(RefSeq) isocitrate lyase (EC:4.1.3.1)
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:aha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AHA_2817 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AHA_2817 (aceA)
Enzymes [BR:aha01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     AHA_2817 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3165064..3166377
Genome map
AA seq 437 aa AA seqDB search
MALTREQQIQAIEKDWAENPRWKGIKRGYSAEDVVNLRGSLQPVHTLAQRGADKLWELIH
GGAKKGYVNCLGALTGGQAVQQAKAGIEAIYLSGWQVAADNNLSSTMYPDQSLYPANSVP
SVVERINNSFARADQIQWANKVGPQDKGFIDYFLPIVADAEAGFGGVLNAFELMKGMIEA
GAAGVHFEDQLASVKKCGHMGGKVLVPSQEAVQKLIAARLAADVCGTTTLVIARTDANAA
DLLTTDADPYDAGFLTGERTSEGFYKVQAGIEQAISRGLAYAPYADMVWCETAKPDLDEA
RKFAEAIKAQYPDKILAYNCSPSFNWKKNLDDATIARFQQELSDMGYKYQFITLAGIHNM
WFHMYELAYQYARGEGMKHYVEMVQQPEFAAAERGYTFVAHQQEVGTGYFDKVTTVIQGG
QSSVTALTGSTEEDQFH
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggcactgacccgtgagcaacagatccaggctatcgagaaagactgggcggaaaacccc
cgctggaaagggatcaagcgcggctacagcgccgaagacgtggtaaacctgcgtggcagc
ctgcaaccggtgcacaccctggcccagcgcggtgccgacaagctgtgggaactgatccac
ggcggcgccaagaaaggctatgtaaactgcctcggcgcgctgactggcggtcaggcggtg
caacaggccaaggcgggcatcgaggcaatttacctctccggctggcaggtggcggcggac
aacaacctctcctccaccatgtacccggatcagtccctctacccggccaactcggtgccg
tcggtggtggagcgcatcaacaactccttcgcccgtgccgaccagatccagtgggccaac
aaggtgggcccgcaggacaagggcttcatcgactacttcctgcctatcgtggcggatgcc
gaagccggtttcggcggcgtgctgaacgcctttgagctgatgaaggggatgattgaagcg
ggcgccgccggcgtgcacttcgaagatcagctcgcctccgtcaagaagtgcggccacatg
ggcggcaaggtgctggtgccgagccaggaagcggtgcagaagttgatcgcggcccgtctg
gcagccgacgtctgcggcaccaccaccctggtgatcgcccgtaccgacgccaacgccgcc
gacctgctgaccacggatgccgatccgtacgatgctggcttcctgaccggtgagcgcacc
tcagaaggcttctacaaggtgcaggccggtatcgaacaggccatctcccgcggtctggcg
tatgccccttacgccgacatggtgtggtgcgaaaccgccaagccggatctggacgaggcg
cgcaagtttgccgaagccatcaaggcccagtacccggacaagatcctggcctacaactgc
tcgccgagtttcaactggaagaaaaacctggacgatgccaccatcgcccgcttccagcag
gagctgtccgacatgggctacaagtaccagttcatcaccctggcgggcatccacaacatg
tggttccacatgtacgagctggcctaccagtacgcccgtggcgaggggatgaagcactat
gtcgaaatggtgcagcagccggaattcgccgctgccgagcgcggttacaccttcgtggca
caccagcaggaagtgggtaccggttacttcgacaaggtcaccaccgtcattcagggcggc
caatcctcggtgaccgccctgaccggctcgaccgaagaagatcagttccactga

DBGET integrated database retrieval system