KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_2905Help
Entry
AHA_2905          CDS       T00424                                 

Gene name
rfbC-1
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:aha00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:aha00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(3264408..3264971)
Genome map
AA seq 187 aa AA seqDB search
MNVIKTELPDILLFEPRVFSDERGFFFESFNHKLFEDAVGYPVTFVQDNHSKSSKGVLRG
LHYQLPPHAQGKLVRCIIGEIFDVAVDIRKSSPTFGRWVGAHLSDTNKRQLWIPEGFAHG
FITRTETAEVLYKATNYYQPDFENSICWNDQQLSIKWDNDMLPVLSRKDASAKSFMMAKK
FNYNFMV
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtaatcaagactgagctccctgacatacttctatttgagcctagggtatttagt
gatgagcgtggctttttctttgaaagtttcaatcataagctatttgaagacgcggtggga
taccctgtcacctttgtacaagataatcactcaaaatcatctaaaggtgtattgcgtggt
ttgcactatcaacttcccccccatgcgcaaggaaagttagtgcgctgtatcattggtgaa
atatttgatgtggcagttgatattcgtaaaagctcgccgacttttgggcgatgggttgga
gcccatttgtcagatacaaacaaacgtcaattatggattcctgaaggatttgctcatgga
ttcatcacaagaacagagaccgcagaagttttatataaagcaactaattattaccaacca
gattttgaaaattcaatatgctggaatgatcagcagctatcaataaaatgggataatgat
atgctccctgtattgtctaggaaagatgcaagtgcaaaatcatttatgatggctaaaaaa
tttaactataatttcatggtgtag

DBGET integrated database retrieval system