KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_2926Help
Entry
AHA_2926          CDS       T00424                                 

Gene name
trpCF
Definition
(RefSeq) bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
aha00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aha01100  Metabolic pathways
aha01110  Biosynthesis of secondary metabolites
aha01130  Biosynthesis of antibiotics
aha01230  Biosynthesis of amino acids
Module
aha_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aha00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AHA_2926 (trpCF)
Enzymes [BR:aha01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     AHA_2926 (trpCF)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     AHA_2926 (trpCF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-GeneID: 4487721
NCBI-ProteinID: YP_857430
UniProt: A0KMC9
Position
3286914..3288299
Genome map
AA seq 461 aa AA seqDB search
MASISQTILGKIVAAKQEWVAARKLAQPLASFQSALIPSDRDFVGVLKAGSTRFILECKK
ASPSKGLIRDDFSPEAIADIYGKYATAISVLTDEKFFQGDFAFLPRVRSRVQQPVLCKDF
MIDPYQVYLARHYQADAILLMLSVLTDEGYRALFAVAKELGLGVLTEVSNEEELTRAIAL
GAPVIGINNRDLRDLSVDLNRTKQLAKDIPSDRVVISESGINHRAQVADLRHHAKGFLVG
SSLMAEPDLEAAVRKLTLGQNKVCGLTRAEDAAAAHQAGAVFGGLIFVAKSPRYVDIPAA
RAVMAGAPLSYVGVFRNAQPATLVKTVEALGLAAVQLHGDEDAAYIEGLRALLPTGCQIW
KAVGVTSGEPLPALDYPADRLLLDTKVGSQSGGTGQAFDWALLATLDKAKLMLAGGLNPD
NALQAAQVGCLGLDFNSGVESAPGQKDAHKLAAAFAALRQL
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggcctccatcagccagaccatcctcggcaagatcgtggcggccaagcaggagtgggtt
gccgcccgcaagctggcccagccgctggcgagcttccagagcgcgctgatccccagcgat
cgggatttcgtcggggtgctcaaggccggttccacccgctttattctggagtgcaagaag
gcctctccctccaagggcttgatccgcgacgacttcagcccggaggcgatcgccgacatc
tatggcaaatacgccaccgccatctcggtgctgaccgacgagaagttctttcagggggat
ttcgccttcctgccgcgggtgcgcagccgtgttcagcagccggtgctctgcaaggatttc
atgattgacccctatcaggtctatctggcccgccactatcaggcggacgccatcctcctg
atgctctcggtgctcaccgacgagggctatcgcgccctgttcgcggtggccaaggagctg
ggccttggcgtgctcaccgaggtgagcaacgaggaggagctgacccgcgccatcgcgctg
ggggcgccggtgatcggtatcaacaaccgggacctgcgcgacttgagcgtcgacctcaac
cgcaccaaacagctggctaaagatattccgagcgatcgggtggtgatcagcgaatccggc
atcaaccaccgcgcccaggtggcggatctgcgccaccatgccaagggcttcctagtgggc
tcgtccctgatggccgagccggatctggaggcggcggtgcgcaagctcactctgggccag
aacaaggtgtgcggcctgacccgcgccgaagacgccgctgcggcccatcaggcaggcgcg
gtattcgggggtcttatctttgtggccaaaagcccgcgctatgtggacattcccgccgcc
cgcgccgtgatggcgggcgcgccgctctcttacgtcggggtatttcgcaacgcccagccc
gccaccctcgtcaagacggtggaggcgctcgggctcgccgcggtgcaactgcacggggat
gaagacgccgcctatatcgagggactgcgagcactgctgccgactggctgccagatctgg
aaggcagttggcgtcacaagcggcgagccgctgcccgccctcgactacccggccgatcgc
ctgctgctggataccaaagtaggcagccagagcggcggcaccggtcaggcattcgactgg
gccctgctggccacgctcgataaagccaagctgatgctggcgggcggccttaatcccgac
aacgccctgcaagccgcgcaagtgggctgcctcggccttgatttcaactccggggtggag
agtgccccgggccaaaaggatgcccacaagctggcggccgcgtttgccgccctgcgccaa
ctgtaa

DBGET integrated database retrieval system