KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_2926Help
Entry
AHA_2926          CDS       T00424                                 

Gene name
trpCF
Definition
bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase (EC:4.1.1.48 5.3.1.24)
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:aha01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:aha00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
3286914..3288299
Genome map
AA seq 461 aa AA seqDB search
MASISQTILGKIVAAKQEWVAARKLAQPLASFQSALIPSDRDFVGVLKAGSTRFILECKK
ASPSKGLIRDDFSPEAIADIYGKYATAISVLTDEKFFQGDFAFLPRVRSRVQQPVLCKDF
MIDPYQVYLARHYQADAILLMLSVLTDEGYRALFAVAKELGLGVLTEVSNEEELTRAIAL
GAPVIGINNRDLRDLSVDLNRTKQLAKDIPSDRVVISESGINHRAQVADLRHHAKGFLVG
SSLMAEPDLEAAVRKLTLGQNKVCGLTRAEDAAAAHQAGAVFGGLIFVAKSPRYVDIPAA
RAVMAGAPLSYVGVFRNAQPATLVKTVEALGLAAVQLHGDEDAAYIEGLRALLPTGCQIW
KAVGVTSGEPLPALDYPADRLLLDTKVGSQSGGTGQAFDWALLATLDKAKLMLAGGLNPD
NALQAAQVGCLGLDFNSGVESAPGQKDAHKLAAAFAALRQL
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggcctccatcagccagaccatcctcggcaagatcgtggcggccaagcaggagtgggtt
gccgcccgcaagctggcccagccgctggcgagcttccagagcgcgctgatccccagcgat
cgggatttcgtcggggtgctcaaggccggttccacccgctttattctggagtgcaagaag
gcctctccctccaagggcttgatccgcgacgacttcagcccggaggcgatcgccgacatc
tatggcaaatacgccaccgccatctcggtgctgaccgacgagaagttctttcagggggat
ttcgccttcctgccgcgggtgcgcagccgtgttcagcagccggtgctctgcaaggatttc
atgattgacccctatcaggtctatctggcccgccactatcaggcggacgccatcctcctg
atgctctcggtgctcaccgacgagggctatcgcgccctgttcgcggtggccaaggagctg
ggccttggcgtgctcaccgaggtgagcaacgaggaggagctgacccgcgccatcgcgctg
ggggcgccggtgatcggtatcaacaaccgggacctgcgcgacttgagcgtcgacctcaac
cgcaccaaacagctggctaaagatattccgagcgatcgggtggtgatcagcgaatccggc
atcaaccaccgcgcccaggtggcggatctgcgccaccatgccaagggcttcctagtgggc
tcgtccctgatggccgagccggatctggaggcggcggtgcgcaagctcactctgggccag
aacaaggtgtgcggcctgacccgcgccgaagacgccgctgcggcccatcaggcaggcgcg
gtattcgggggtcttatctttgtggccaaaagcccgcgctatgtggacattcccgccgcc
cgcgccgtgatggcgggcgcgccgctctcttacgtcggggtatttcgcaacgcccagccc
gccaccctcgtcaagacggtggaggcgctcgggctcgccgcggtgcaactgcacggggat
gaagacgccgcctatatcgagggactgcgagcactgctgccgactggctgccagatctgg
aaggcagttggcgtcacaagcggcgagccgctgcccgccctcgactacccggccgatcgc
ctgctgctggataccaaagtaggcagccagagcggcggcaccggtcaggcattcgactgg
gccctgctggccacgctcgataaagccaagctgatgctggcgggcggccttaatcccgac
aacgccctgcaagccgcgcaagtgggctgcctcggccttgatttcaactccggggtggag
agtgccccgggccaaaaggatgcccacaagctggcggccgcgtttgccgccctgcgccaa
ctgtaa

DBGET integrated database retrieval system