KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_2928Help
Entry
AHA_2928          CDS       T00424                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aha00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AHA_2928 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AHA_2928 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AHA_2928 (trpA)
Enzymes [BR:aha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AHA_2928 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
3289570..3290376
Genome map
AA seq 268 aa AA seqDB search
MNRYAQLFSRLDEANQGAFVPFVMLGDPTPELSLAIVDALVAGGADALELGIPFSDPVAD
GPTIQGAALRAFESHTTPDDCFELLGRIRAKYPQLPIGLLVYANLVYVRKIDGFYEKCQQ
AGVDSVLVADVPVQMCAPYKAAADKFGIDSIFIAPPNGDAETLKQVAELGNGYTYLVSRA
GVTGAETKAGMPVEGLINTLREFNAPPALLGFGISEPTQVREAIAAGAAGAISGSAVVKI
IETHHQNPEHMLNRLKEFVEGMKAATNR
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgttacgcacaactcttctcccgtctggacgaagccaatcagggcgcctttgtg
ccgttcgtgatgctgggtgaccccacccccgaattgtcgctggccatcgtcgatgcgctg
gtcgcagggggcgccgatgccctcgagctcggcattcccttctcggatccagtggcggac
ggccccaccattcagggcgccgccctgcgcgcctttgagagccacaccaccccggacgac
tgcttcgagctgcttggccgcatccgcgccaagtacccgcagctgcccattggcctcttg
gtctacgccaacctggtctatgtgcgcaaaattgacggcttttacgagaagtgccagcag
gccggcgtggattcggtgctggtggccgacgtgccggtgcagatgtgcgccccctacaag
gcggccgccgacaagttcggtatcgacagcatctttatcgccccgcccaatggcgatgcc
gaaaccctgaaacaggtggcggagctcggcaatggttacacctatctggtgagccgcgcc
ggtgtgaccggtgccgagaccaaggccggcatgccggtggagggcctcatcaataccctg
cgcgagttcaatgccccccccgccctgctcggctttggtatcagcgagccgactcaggta
cgtgaagcgattgccgctggcgccgccggtgccatctccggctccgccgtggtgaagatc
atcgagacccaccaccagaatccggagcatatgctgaaccgtctgaaagagtttgtggaa
gggatgaaggcggcgaccaatcgataa

DBGET integrated database retrieval system