KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_3016Help
Entry
AHA_3016          CDS       T00424                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:aha00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AHA_3016 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AHA_3016 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    AHA_3016 (thrC)
Enzymes [BR:aha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     AHA_3016 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3403482..3404756)
Genome map
AA seq 424 aa AA seqDB search
MNLYNIKDKSEQVSFAQAVRQGLGREQGLFFPERLEPLADVDALLDLPLVERSARILSHL
LGDEVPAPQVHELVKAAFTFPAPLVKLKDGTYALELFHGPTLAFKDFGGRFMAQCLAAFR
TNDKITILTATSGDTGAAVAHAFFGLEGIEVVILYPKGKISPLQEALFCTLGGNIRTIAI
DGDFDACQALVKQSFDDEELKKAIGLNSANSINISRLLAQVCYYFEAVAQLPKADRAKAV
ISVPSGNFGNLTAGLIAKALGLPVKRFIAATNANDTVPRYLKTGQWDPHQTVATLSNAMD
VSRPNNWPRVEELCRRNGWALETLGSGMRSDAQTRDALKRLHELDYLCEPHGAIAWDLLG
EQLAEDEVGVFLCTAHPAKFKESVDEILGLDVPLPGPLAKHAVLPLLSHNLPAEFARLRA
FLLG
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaatctttacaatatcaaggacaagagtgaacaggtgagcttcgcccaggcggtgcgt
cagggtctgggccgcgaacagggtctgttcttccccgagcggctcgagccgttggccgac
gtcgatgctctgctcgatctgccgctggtggagcgttccgcccgcatcctcagccacctg
ctgggggacgaagtgcccgcgcctcaggtacacgaactggtcaaggctgccttcaccttc
ccggcgccgctggtgaagctcaaggatggcacctatgcccttgagctgttccacggcccg
accctggcgttcaaggatttcggcggccgctttatggcccagtgtttggctgcgttccgt
accaacgacaagatcactatcctcaccgccacctccggcgacaccggcgccgccgtggcc
cacgccttcttcgggctggaggggatcgaggtggtgatcctctaccctaagggcaagata
agcccgctgcaggaggcgctgttctgcaccttagggggcaacatccgcaccatcgccatc
gacggcgacttcgatgcctgccaggcgctggtgaagcaatccttcgatgacgaggagctg
aagaaggccattggtctgaactccgccaactccatcaacatcagccgtttgctggcccag
gtttgctactacttcgaggcggtggcccagttgccaaaagccgatcgtgccaaggcggtc
atcagcgtgccgtccggcaactttggcaacctcaccgcaggccttatcgccaaggcgctg
gggctgccggtgaagcgctttatcgccgccaccaacgccaacgataccgtgccgcgctac
ctgaaaaccggccagtgggatccgcaccagacagtggcaaccctgtcgaacgccatggat
gtgagccgccccaacaactggcctagggtagaagagctgtgccgtcgcaacggctgggcg
ctggaaaccctgggttctggcatgcgcagtgatgcccaaactcgcgatgcactcaagcgc
ctgcatgagctggattacctgtgcgaacctcatggcgccattgcctgggatctgctgggc
gaacagctggctgaggatgaagtgggggtgttcctctgcaccgcccatccggccaagttc
aaggagtcggtagacgagatcctggggttggacgtgccgctgcccggcccgctcgccaag
cacgccgtgctgccgctcttgtcccacaacctgccggcggagtttgctcgcctaagagcc
ttcctgctcggttaa

DBGET integrated database retrieval system