KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_3100Help
Entry
AHA_3100          CDS       T00424                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:aha00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:aha00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
3500339..3502207
Genome map
AA seq 622 aa AA seqDB search
MSAPLIHTRVDRRDGDDVWFRFSLSQLPDAPWKLHFCLARHIDPGSVEGGELERQSGSYK
VLIPQTGASELCFCCRNTPIKRLSDMPRGFFLSLPQANGGPQLMPVELTGEELGLPQSAA
AAPDLPEVEPLAGIVPQPDRLLLLEGNFRLAERAHVSGPSPLLGPLLAHFNELTGLALAQ
DHDAEIRLVESGLGPEAYRLTITPEEIVIAASGEAGWRHGLVSLAQWYLQHGESLPCIEL
SDAPRFGFRGIFLDCARHFHSLATLKRLLRLMSLYKFNRFHWHLTDDEGWRLEIKAFPQL
TELAAWRGHALPVGPQLSGGPEPYGGYYTQSEVRELVAYGAGLGITIIPEIDIPGHCHAA
IKALPELLVEEADRSRYLSVQYFDDNVLNPALPGTYRFLEAVMDEVCELFPGPLVHMGGD
EVPAGVWTDSPACQQLMKQQGYQDCRELQGHLLRHCQQYLAGKGKRMLGWEEILHGDKVS
RDATIFAWTSFQAGLDAATAGYPVVMAPAQHLYLDLAWSQDIHEPGLYWAGTLNLAQVYA
CDPAPADFHANDNILGVLSPLWSELITSRDRLDYMLFPRMLATAEVAWSDPARKAWEHFA
ARLPGQLQILDQLQVRYRVPQR
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcacccctgatccacacccgggtcgaccgacgcgacggtgacgacgtctggttt
cgtttcagcctgagccagctgccggatgccccttggaaactccacttctgcctggcccgc
cacatcgaccccggctcggtagaggggggtgagctggagcgccagagcggcagctacaag
gtcttgatcccgcaaacgggggccagcgagctgtgcttctgctgccgcaacacccccatc
aagcgcctctccgacatgccgcgcggcttcttcctgagcctgccccaggccaacggcggc
ccccagctgatgccggtggaactgaccggcgaggagctgggcctgccgcaatccgccgct
gcggcgccggatctgcccgaggtggaacccctcgccggcatcgtgccccagccggatcgg
ctgttgttgctggagggcaacttccggctggcggagcgcgcccacgttagcggcccgagc
cccctgctcggcccgctgctggcccacttcaacgaactgaccgggctcgcgctggcgcag
gatcacgacgccgagatccggctggttgaaagcggtctgggcccggaggcctaccggctg
accatcaccccggaggagatagtgattgccgccagcggcgaggcgggctggcgccacggc
ctcgtcagcctggcccagtggtatctgcagcacggcgagagcctgccctgcatcgagctc
agcgatgcaccgcgcttcggttttcgcggcatctttctcgactgtgcccgccactttcac
tctctcgccaccctcaagcgcctgctcaggctgatgagcctctacaagttcaaccgcttc
cactggcacctgaccgatgacgaggggtggcgactcgagatcaaggccttcccccagctg
accgagctggccgcctggcgcggtcacgccctgccggtggggccccagctgagcggcggc
ccagaaccctacggcggctactacacccagagcgaggtgcgcgagctggtggcctacggc
gccgggctcggcatcaccatcattccggaaatagacatcccgggtcactgccatgccgcc
atcaaggcgctgcccgagctgctggtggaggaggccgaccgctcccgctacctgtcggtg
caatatttcgacgacaacgtgctcaacccggcgctgcccggcacctaccgcttcctggaa
gccgtgatggacgaggtatgcgaactgttccctgggccgctggtgcacatggggggggac
gaggtgcccgccggggtctggaccgacagtcccgcctgccagcagttgatgaagcagcag
gggtatcaggattgccgcgagctgcagggccacctgctgcgtcactgccagcagtacctg
gccggcaagggcaagcggatgctgggctgggaggagattttgcacggcgataaggtgagc
cgggacgccaccatcttcgcctggaccagcttccaggccgggctcgacgcggccaccgcc
ggttatccggtggtgatggcaccggcccagcacctctatctggatctcgcctggagccag
gacatccatgaacccggcctctactgggcgggcaccctcaatctggcgcaggtctacgca
tgtgacccggccccagccgatttccatgccaacgataacatcctgggggtgctgagcccc
ttatggtcggagctgatcacctctcgcgatcgcctcgactatatgttgttcccgcgcatg
ctggcgaccgccgaggtggcctggagcgaccccgcccgcaaggcgtgggagcacttcgcc
gcccgtctgccgggccagctgcagatcctcgaccagcttcaggtgcgttaccgggtacca
cagaggtag

DBGET integrated database retrieval system