KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_3309Help
Entry
AHA_3309          CDS       T00424                                 

Gene name
tpiA-2
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AHA_3309 (tpiA-2)
   01230 Biosynthesis of amino acids
    AHA_3309 (tpiA-2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AHA_3309 (tpiA-2)
   00051 Fructose and mannose metabolism
    AHA_3309 (tpiA-2)
   00562 Inositol phosphate metabolism
    AHA_3309 (tpiA-2)
Enzymes [BR:aha01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     AHA_3309 (tpiA-2)
Exosome [BR:aha04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   AHA_3309 (tpiA-2)
  Exosomal proteins of bladder cancer cells
   AHA_3309 (tpiA-2)
  Exosomal proteins of melanoma cells
   AHA_3309 (tpiA-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3728020..3728784)
Genome map
AA seq 254 aa AA seqDB search
MGHRKPFVAANWKLHGSRSQLEQFTGQCLKGVDERVDVVLCPSHVHLDFTAALLGEQRTM
KLGAQNVSQHRQGAYTGEISCQMLVEAGCRYVLVGHSERRRLFGETSFIVAEKFAAARAA
GLIPILCLGESGAARQARRTFEVIAEELDIVIEKNGAMAFDNAIIAYEPIWAVGTGKCAT
PEQAQEVHSFIRGRLAEDTPVIGEKVRIIYGGSVTPANARELFAQPDVDGGLIGGASLDD
QTFLGIVEAAKGAS
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgggacatcgcaagccgtttgtagcagccaactggaagttacacggtagtaggtcgcag
ttagagcagtttactggtcaatgtctgaagggcgttgatgaacgagtagacgtggtcttg
tgtccatcccatgtgcatctcgactttacggccgcattgctcggtgagcagcgaacaatg
aagttgggggctcagaatgtgagccagcacagacagggcgcttacacgggggaaatctcg
tgtcagatgctggtcgaggcagggtgtcgatacgtactggtagggcactccgagcgcagg
cgtctctttggtgagaccagttttatcgtcgcagagaagtttgcggcagccagagcggca
ggtctgattcccatcctctgtttgggtgaatcaggggcggcgaggcaggcgagaagaacc
ttcgaggtgatcgccgaagagctggacatcgtcatagagaaaaatggcgcgatggctttc
gataatgctatcatcgcctacgagccgatttgggctgtaggtacaggtaaatgcgccaca
cccgagcaggcacaagaggttcattcctttatacgtggtcgcttggcggaggatactccg
gtcataggtgagaaagttagaatcatctatggtgggagcgtgacgccggccaatgcgaga
gagttgtttgcccagcccgacgttgacggcggcctaattggtggagcaagtctcgatgac
cagacgtttttaggaattgttgaagcggcaaagggtgcaagttaa

DBGET integrated database retrieval system