KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_3309Help
Entry
AHA_3309          CDS       T00424                                 

Gene name
tpiA-2
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
aha00010  Glycolysis / Gluconeogenesis
aha00051  Fructose and mannose metabolism
aha00562  Inositol phosphate metabolism
aha01100  Metabolic pathways
aha01110  Biosynthesis of secondary metabolites
aha01120  Microbial metabolism in diverse environments
aha01130  Biosynthesis of antibiotics
aha01200  Carbon metabolism
aha01230  Biosynthesis of amino acids
Module
aha_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
aha_M00002  Glycolysis, core module involving three-carbon compounds
aha_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AHA_3309 (tpiA-2)
   00051 Fructose and mannose metabolism
    AHA_3309 (tpiA-2)
   00562 Inositol phosphate metabolism
    AHA_3309 (tpiA-2)
Enzymes [BR:aha01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     AHA_3309 (tpiA-2)
Exosome [BR:aha04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   AHA_3309 (tpiA-2)
  Exosomal proteins of bladder cancer cells
   AHA_3309 (tpiA-2)
  Exosomal proteins of melanoma cells
   AHA_3309 (tpiA-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 4490971
NCBI-ProteinID: YP_857798
UniProt: A0KNE7
Position
complement(3728020..3728784)
Genome map
AA seq 254 aa AA seqDB search
MGHRKPFVAANWKLHGSRSQLEQFTGQCLKGVDERVDVVLCPSHVHLDFTAALLGEQRTM
KLGAQNVSQHRQGAYTGEISCQMLVEAGCRYVLVGHSERRRLFGETSFIVAEKFAAARAA
GLIPILCLGESGAARQARRTFEVIAEELDIVIEKNGAMAFDNAIIAYEPIWAVGTGKCAT
PEQAQEVHSFIRGRLAEDTPVIGEKVRIIYGGSVTPANARELFAQPDVDGGLIGGASLDD
QTFLGIVEAAKGAS
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgggacatcgcaagccgtttgtagcagccaactggaagttacacggtagtaggtcgcag
ttagagcagtttactggtcaatgtctgaagggcgttgatgaacgagtagacgtggtcttg
tgtccatcccatgtgcatctcgactttacggccgcattgctcggtgagcagcgaacaatg
aagttgggggctcagaatgtgagccagcacagacagggcgcttacacgggggaaatctcg
tgtcagatgctggtcgaggcagggtgtcgatacgtactggtagggcactccgagcgcagg
cgtctctttggtgagaccagttttatcgtcgcagagaagtttgcggcagccagagcggca
ggtctgattcccatcctctgtttgggtgaatcaggggcggcgaggcaggcgagaagaacc
ttcgaggtgatcgccgaagagctggacatcgtcatagagaaaaatggcgcgatggctttc
gataatgctatcatcgcctacgagccgatttgggctgtaggtacaggtaaatgcgccaca
cccgagcaggcacaagaggttcattcctttatacgtggtcgcttggcggaggatactccg
gtcataggtgagaaagttagaatcatctatggtgggagcgtgacgccggccaatgcgaga
gagttgtttgcccagcccgacgttgacggcggcctaattggtggagcaagtctcgatgac
cagacgtttttaggaattgttgaagcggcaaagggtgcaagttaa

DBGET integrated database retrieval system