KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_3344Help
Entry
AHA_3344          CDS       T00424                                 

Gene name
acsA
Definition
(RefSeq) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
aha00010  Glycolysis / Gluconeogenesis
aha00620  Pyruvate metabolism
aha00640  Propanoate metabolism
aha00680  Methane metabolism
aha01100  Metabolic pathways
aha01110  Biosynthesis of secondary metabolites
aha01120  Microbial metabolism in diverse environments
aha01130  Biosynthesis of antibiotics
aha01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AHA_3344 (acsA)
   00620 Pyruvate metabolism
    AHA_3344 (acsA)
   00640 Propanoate metabolism
    AHA_3344 (acsA)
  Energy metabolism
   00680 Methane metabolism
    AHA_3344 (acsA)
Enzymes [BR:aha01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     AHA_3344 (acsA)
Lipid biosynthesis proteins [BR:aha01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   AHA_3344 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-GeneID: 4490124
NCBI-ProteinID: YP_857833
UniProt: A0KNI2
Position
3763195..3765141
Genome map
AA seq 648 aa AA seqDB search
MSESKVYPVKAHISNGALLDKAGYEAMYRASVQDPDAFWGEQGKILDWMKPYTRVKNTSY
DPGHVSIKWYEDGLLNVSANCLDRHLAQRGDKVAIIWEGDNPAEDRKLTYRELHTEVCKF
ANVLKAQGVHRGDVVCLYMPMVPEAAIAMLACTRIGAVHSIVFGGFSPEALAGRIIDSGS
SIVITADEGLRGGRPVPLKKNVDEALTNPETKVNNVIVLKRTGGNIAWHNHRDIWWHDAV
ATVSADCPPEAMGAEDPLFILYTSGSTGKPKGVLHTTGGYLVYATLTFKYIFDYHEEDIY
WCTADVGWVTGHSYLVYGPLANGATTIMFEGVPNYPATNRMSQVVDKHQVSILYTAPTAI
RALMAKGNEAVADTSRSSLRIMGSVGEPINPEAWEWYYRTIGEERCPIVDTWWQTETGGI
LISPLPGVTDLKPGSATRPFFGVQPALVDNMGEPLEGATEGNLVITDSWPGQMRTVFGDH
ERFEQTYFSTFPGRYFTGDGARRDEDGYYWITGRVDDVLNVSGHRMGTAEIESALVSHPK
IAEAAVVGVPHEIKGQGIYAYVTLIAGEEPSRELHKEVKEWVRKEIGAIATPDVIHWAEG
LPKTRSGKIMRRILRKIATGETDSLGDISTLADPGVVDKLIREKSEAA
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagagcaaggtctacccggtcaaagcccacatcagcaacggcgccctgctggac
aaggcaggctatgaagccatgtaccgggcctcggtgcaggatccggatgccttctggggc
gagcagggcaagatcctcgactggatgaagccctacaccagggtcaagaacacctcctat
gatccgggccacgtctccatcaaatggtatgaagacggcctgctcaacgtctctgccaac
tgtctggaccgccatctggcccagcgcggcgacaaggtcgccatcatctgggaaggagac
aacccggccgaagatcgcaagctcacctaccgcgagctgcacaccgaggtgtgcaagttt
gccaacgtcttgaaggcgcagggggtgcatcgcggcgacgtggtctgcctctacatgccc
atggtgccggaagccgccatcgccatgctggcctgtacccgcatcggcgcggtgcacagc
atcgtgttcggcggtttctcgccggaagccctggccggtcgcatcatcgactccggctcc
tccatcgtcatcaccgccgatgaagggctgcgcggcggccgcccggtaccgctcaagaag
aacgtggatgaagcactcaccaacccggagaccaaggtcaacaatgtgatcgtgctcaaa
cgcaccggcggcaacatcgcctggcacaaccacagggacatctggtggcacgacgcagtc
gccaccgtcagcgccgactgcccgcccgaggcgatgggggctgaagatccgctcttcatc
ctctacacctccggctccaccggcaaacccaagggggtgctgcacaccaccggcggctat
ctggtctatgccactctcaccttcaagtacatcttcgactaccacgaagaggacatctac
tggtgtaccgccgacgtgggttgggtcaccggccactcctatctggtctacgggccgctt
gccaacggtgccaccaccatcatgttcgaaggggtgcccaactacccggccaccaaccgc
atgagccaggtggtggacaagcaccaggtcagcatcctctacaccgcccccaccgccatc
cgggcgctgatggccaagggcaacgaggcagtagccgacacctcccgttcgagcctgcgc
atcatgggctcggtgggcgagcccatcaacccggaagcctgggagtggtactaccgcacc
atcggcgaggagcgctgccccatcgtcgatacctggtggcaaaccgagaccggcggcatc
ctgatcagcccgctgcccggcgtcaccgatctcaagcctggctcggctacccgtcccttc
ttcggcgtgcaaccggcgctggtggacaacatgggcgagccgctggagggggccaccgag
ggcaacctggtgatcaccgactcctggccgggccagatgcgcaccgtgttcggcgatcac
gagcggttcgagcagacctacttctccaccttccccggccgctacttcaccggcgacggt
gcccgtcgcgatgaggatggttactactggatcaccggacgggtggatgatgtactgaac
gtctccggtcaccgcatgggcaccgccgaaattgaatccgcgctggtttcccatcccaag
atcgccgaagcggcggtggtgggcgtgccacacgagatcaagggtcagggcatctatgcc
tatgtcaccctgatcgccggcgaggagccgagccgggagctgcacaaggaggtgaaggag
tgggtccgcaaggagatcggcgccatcgccaccccggacgtgatccactgggccgagggg
ctgccaaagacccgctccggcaagatcatgcggcgaattctgcgcaagatcgccaccggc
gagaccgacagcctgggggatatctccaccctggcggatccgggcgtggtggacaagctg
atccgcgagaagtcggaagccgcctga

DBGET integrated database retrieval system