KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_3344Help
Entry
AHA_3344          CDS       T00424                                 

Gene name
acsA
Definition
acetyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:aha01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:aha00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:aha00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:aha00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:aha00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
3763195..3765141
Genome map
AA seq 648 aa AA seqDB search
MSESKVYPVKAHISNGALLDKAGYEAMYRASVQDPDAFWGEQGKILDWMKPYTRVKNTSY
DPGHVSIKWYEDGLLNVSANCLDRHLAQRGDKVAIIWEGDNPAEDRKLTYRELHTEVCKF
ANVLKAQGVHRGDVVCLYMPMVPEAAIAMLACTRIGAVHSIVFGGFSPEALAGRIIDSGS
SIVITADEGLRGGRPVPLKKNVDEALTNPETKVNNVIVLKRTGGNIAWHNHRDIWWHDAV
ATVSADCPPEAMGAEDPLFILYTSGSTGKPKGVLHTTGGYLVYATLTFKYIFDYHEEDIY
WCTADVGWVTGHSYLVYGPLANGATTIMFEGVPNYPATNRMSQVVDKHQVSILYTAPTAI
RALMAKGNEAVADTSRSSLRIMGSVGEPINPEAWEWYYRTIGEERCPIVDTWWQTETGGI
LISPLPGVTDLKPGSATRPFFGVQPALVDNMGEPLEGATEGNLVITDSWPGQMRTVFGDH
ERFEQTYFSTFPGRYFTGDGARRDEDGYYWITGRVDDVLNVSGHRMGTAEIESALVSHPK
IAEAAVVGVPHEIKGQGIYAYVTLIAGEEPSRELHKEVKEWVRKEIGAIATPDVIHWAEG
LPKTRSGKIMRRILRKIATGETDSLGDISTLADPGVVDKLIREKSEAA
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagagcaaggtctacccggtcaaagcccacatcagcaacggcgccctgctggac
aaggcaggctatgaagccatgtaccgggcctcggtgcaggatccggatgccttctggggc
gagcagggcaagatcctcgactggatgaagccctacaccagggtcaagaacacctcctat
gatccgggccacgtctccatcaaatggtatgaagacggcctgctcaacgtctctgccaac
tgtctggaccgccatctggcccagcgcggcgacaaggtcgccatcatctgggaaggagac
aacccggccgaagatcgcaagctcacctaccgcgagctgcacaccgaggtgtgcaagttt
gccaacgtcttgaaggcgcagggggtgcatcgcggcgacgtggtctgcctctacatgccc
atggtgccggaagccgccatcgccatgctggcctgtacccgcatcggcgcggtgcacagc
atcgtgttcggcggtttctcgccggaagccctggccggtcgcatcatcgactccggctcc
tccatcgtcatcaccgccgatgaagggctgcgcggcggccgcccggtaccgctcaagaag
aacgtggatgaagcactcaccaacccggagaccaaggtcaacaatgtgatcgtgctcaaa
cgcaccggcggcaacatcgcctggcacaaccacagggacatctggtggcacgacgcagtc
gccaccgtcagcgccgactgcccgcccgaggcgatgggggctgaagatccgctcttcatc
ctctacacctccggctccaccggcaaacccaagggggtgctgcacaccaccggcggctat
ctggtctatgccactctcaccttcaagtacatcttcgactaccacgaagaggacatctac
tggtgtaccgccgacgtgggttgggtcaccggccactcctatctggtctacgggccgctt
gccaacggtgccaccaccatcatgttcgaaggggtgcccaactacccggccaccaaccgc
atgagccaggtggtggacaagcaccaggtcagcatcctctacaccgcccccaccgccatc
cgggcgctgatggccaagggcaacgaggcagtagccgacacctcccgttcgagcctgcgc
atcatgggctcggtgggcgagcccatcaacccggaagcctgggagtggtactaccgcacc
atcggcgaggagcgctgccccatcgtcgatacctggtggcaaaccgagaccggcggcatc
ctgatcagcccgctgcccggcgtcaccgatctcaagcctggctcggctacccgtcccttc
ttcggcgtgcaaccggcgctggtggacaacatgggcgagccgctggagggggccaccgag
ggcaacctggtgatcaccgactcctggccgggccagatgcgcaccgtgttcggcgatcac
gagcggttcgagcagacctacttctccaccttccccggccgctacttcaccggcgacggt
gcccgtcgcgatgaggatggttactactggatcaccggacgggtggatgatgtactgaac
gtctccggtcaccgcatgggcaccgccgaaattgaatccgcgctggtttcccatcccaag
atcgccgaagcggcggtggtgggcgtgccacacgagatcaagggtcagggcatctatgcc
tatgtcaccctgatcgccggcgaggagccgagccgggagctgcacaaggaggtgaaggag
tgggtccgcaaggagatcggcgccatcgccaccccggacgtgatccactgggccgagggg
ctgccaaagacccgctccggcaagatcatgcggcgaattctgcgcaagatcgccaccggc
gagaccgacagcctgggggatatctccaccctggcggatccgggcgtggtggacaagctg
atccgcgagaagtcggaagccgcctga

DBGET integrated database retrieval system