KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_3403Help
Entry
AHA_3403          CDS       T00424                                 

Definition
cytochrome c551 peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Brite
Enzymes [BR:aha01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     AHA_3403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3828292..3829269)
Genome map
AA seq 325 aa AA seqDB search
MNKYCLLLALGLPGMGWANEPIQPVEAAKVSAPEKVELGKMLFFEPRLSKSNAISCNSCH
NLATGGVDNQVSSLGHKWKEGPINSPTVLNSSLNFVQFWDGRAKDLQAQAAGPIENPLEM
AFTHKLAVETLHTLPEYRARFSAVYGKADFGIDEVTDAIAAFEETLVTPNAPFDRWLKGD
AKALTAQQLKGYQLFKDKGCTACHNGVAIGGNSYQKMGLVKPFKTDNPAQGRGGVTGEKQ
FIGWFKVPTLRNIELTYPYFHDGSVWDLKEAVQIMADIQLGQTLSEQEADDMTAYLKSLT
GEQPQIVLPILPPSQPDTPRPQVKS
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatattgtctgttgctggcgctgggcctgccagggatggggtgggcgaacgag
ccgatccagccggtggaagcggccaaggtgagcgcaccggaaaaagtcgagctgggcaag
atgctgttcttcgagccgcggctctcgaaatccaacgccatctcctgcaactcctgccac
aacctggcgaccggcggggtagacaaccaggtcagttccctcggccacaagtggaaggag
gggccgatcaactcgcccaccgtgctcaactccagcctcaacttcgtgcagttctgggat
ggtcgcgccaaggatctgcaggcgcaggcggcgggccccatcgagaatccgctggagatg
gccttcacccacaagctggcggtagagaccctgcacaccctgcccgagtaccgggcccgg
ttcagcgccgtgtacggcaaggcggacttcggcatcgacgaggtgaccgatgccatcgcc
gccttcgaggagaccctggtcacccccaacgcgccgttcgatcgctggctgaagggagat
gccaaggcgctgaccgcgcagcagttgaagggttatcagctgttcaaggataagggctgc
accgcctgccacaacggggtggccatcggcggcaactcctaccagaagatggggctggtc
aagccgttcaagaccgacaacccggcccagggacgcggcggggtgaccggcgagaagcag
ttcatcggctggttcaaggtgccgaccctgcgcaacatcgagctgacctacccctacttc
cacgacggatctgtgtgggatctgaaggaggcggtgcagatcatggcggacatccagctc
ggccagaccctgagcgagcaggaggcggacgacatgaccgcctacctcaagagcctgacc
ggcgagcagccgcagatagtgttgcctattctgccgccctcccaacccgatacccccagg
cctcaggtcaagagctga

DBGET integrated database retrieval system