KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_3489Help
Entry
AHA_3489          CDS       T00424                                 

Definition
acyl-CoA thioesterase (EC:3.1.1.5 3.1.2.-)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:aha00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    AHA_3489
Enzymes [BR:aha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     AHA_3489
   3.1.2  Thioester hydrolases
    3.1.2.-  
     AHA_3489
Lipid biosynthesis proteins [BR:aha01004]
 Fatty acid synthase
  Component type
   AHA_3489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3913814..3914413
Genome map
AA seq 199 aa AA seqDB search
MTRFLFALCCLVSSVQAQTLLVLGDSLSAGYQMPAEQSWPALLNQKWQQQGGKHQLINAS
ISGETTQGALARLPALLKEHQPDWVLIELGGNDGLRGFAPAITRDNLTRMVALTKAQQVK
TVLTQIQLPRNYGARYLRQFEQIFPELASANQLPLMPFFMDDIALRPELMMNDGIHPTAA
AQPQIRDRVASFIEPLLTQ
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgtttcctgtttgccttgtgctgcctggtgtcatcggtgcaggcccagaccctg
ctggtactgggcgacagcctgagtgcaggttatcagatgccggcggagcagagctggcct
gcgctgctcaatcagaaatggcagcagcaggggggtaaacatcagcttatcaatgccagc
atcagtggtgaaactacgcaaggggcgctggccagattgccggccctgctcaaggaacat
caaccggactgggtgctgatcgagctgggtggcaacgacgggctgcgcgggttcgcgccg
gccattacccgggacaatctcaccaggatggtggcgctgaccaaggcgcaacaggtaaaa
accgtgctgacccagatccagctgccgcgcaactacggcgcgcgctacctgcgccagttc
gagcagatcttcccggaactggccagcgccaatcagctgccgctgatgcccttcttcatg
gatgatattgcgctgcgccctgaactcatgatgaacgatggcatccaccccaccgccgcc
gcccagccgcagatccgcgaccgggtggccagcttcatcgagccgctgctgacccagtga

DBGET integrated database retrieval system