KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_3497Help
Entry
AHA_3497          CDS       T00424                                 

Gene name
cysQ-2
Definition
3'(2'),5'-bisphosphate nucleotidase (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aha00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    AHA_3497 (cysQ-2)
Enzymes [BR:aha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     AHA_3497 (cysQ-2)
Transfer RNA biogenesis [BR:aha03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    AHA_3497 (cysQ-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3936313..3937104)
Genome map
AA seq 263 aa AA seqDB search
MTRMSFLMFFPAISELEPIARTAGDAIMAIYSQPFAVEYKQDESPLTAADKGAHEVIVQA
LARLTPDIPVLSEESGPEVMAARHGWSRYWLVDPLDGTKEFVFRNGEFTVNIALIEEGAP
RWGLVYAPVLDLLWYGGKGLGAWRVAGGKREAIQSRPHQESTPWRVVGSRNHLSQATLDY
LAGFGDMARGEIELVSMGSSLKFCIIAEGGAELYPRLAPTCEWDTGAAQAVLEGAGGSVT
QLDGSPLCYNKPDILNPWFVAKA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
ttgaccaggatgtcttttcttatgttttttcccgcgatttccgagctggagcccatcgcc
cgtaccgccggtgacgccatcatggccatctacagtcagccctttgcggtagagtacaag
caggacgaaagccccttgaccgccgccgacaagggcgcgcacgaggtgatcgtgcaggcg
ttggcccggttgacgcccgacatccccgtattgtccgaggagtccgggcccgaggtgatg
gcggcgcgccacggctggtcccgttactggctggtggacccgctggacggcaccaaggag
ttcgtcttccgcaacggcgagttcaccgtcaatatcgccctcattgaagaaggggctccg
cgctgggggctggtttatgccccggtattggacctgctctggtatggcggcaaggggctg
ggggcctggcgggtggctggtggcaagcgtgaggcaatccagagccgacctcatcaggag
agcacgccttggcgggtggtgggcagtcgcaatcacttgtcccaggccactctggattac
ctggctggctttggtgacatggcgcggggcgagattgagctggtttccatgggcagttcg
ctcaagttctgcatcatcgccgaagggggcgccgagctttacccgcgcctcgcccccacc
tgcgagtgggataccggtgcggcgcaggcggtgctggagggagcgggcggcagtgtaacc
cagctcgatggctcgccgctgtgctacaacaagccggacatcctcaacccctggttcgtg
gccaaggcataa

DBGET integrated database retrieval system