KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_3499Help
Entry
AHA_3499          CDS       T00424                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:aha00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:aha00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:aha00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:aha00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
3937685..3938578
Genome map
AA seq 297 aa AA seqDB search
MVRKAVLPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYVVREAIAAGIKEIILVTHSSKN
SIENHFDKSFELEATLEKRVKRQLLEEVQHICPKDVTIMHVRQGEAKGLGHAVLCARPLI
GDNPFAVLLPDVLIDEVASNPKQDNLAEMVHMFEEDHISQIMVEAVPESEVDKYGIADIK
GEALSEGMSLPMQAIVEKPPRDEAPSNLAVVGRYVLSSNIWPLLEKTPAGAGDEIQLTDA
IAMLMEQEQVNAYFMKGRSHDCGSKFGYMKANVEYAVRHPELNGEFIIWLKQFAKQL
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
gtggtccgcaaagccgttcttcccgtcgccggtctgggcacccgcatgttgccagccacc
aaggccatccccaaggagatgctgcccgtcgtcgacaaaccgctgatccagtatgtagtg
cgcgaagccatcgccgccggcatcaaggagatcatcctggtcacccactcgagcaagaac
tccatcgaaaaccacttcgacaagagcttcgagctggaagcgaccctcgagaagcgggtc
aagcggcaactgctggaagaggtgcaacacatctgcccgaaagacgtcaccatcatgcac
gtccgccagggggaagccaaaggtctggggcacgcggtgctctgcgcccgcccgctgatc
ggcgacaacccgtttgcggtattgctgccggacgtgctgatcgacgaggtggccagcaat
cccaagcaggacaacctggccgagatggtgcacatgttcgaagaggatcacatcagccag
atcatggtggaagccgtccccgagagtgaagtggacaaatacggcatcgccgacatcaag
ggagaagctctgagcgagggcatgtctctgccgatgcaggccatcgttgagaaacccccc
cgtgacgaggccccctccaatctggccgtggtcggccgttacgtgctctcttccaacatc
tggccgctgctagagaagacccccgccggtgccggcgacgagatccagctgaccgatgcc
atcgccatgctgatggagcaggagcaggtgaatgcctacttcatgaaagggcgcagccac
gactgcggtagcaagttcggttacatgaaagccaacgtggaatatgcagtgcgccatccg
gaactgaacggcgaatttatcatttggttgaaacagtttgccaagcagctgtaa

DBGET integrated database retrieval system