KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_3537Help
Entry
AHA_3537          CDS       T00424                                 

Gene name
folK-1
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:aha00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AHA_3537 (folK-1)
Enzymes [BR:aha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     AHA_3537 (folK-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
3979071..3979580
Genome map
AA seq 169 aa AA seqDB search
MTEVFIAIGSNLSDPLGQARRAVAALARLPGSVLVQASSFYSSRPMGPADQPDYVNAVAR
LNTRLTPLALLDQLQSIELEQGRVRKDERWGPRTLDLDLLLFGDQIIRHERLIVPHYGMK
EREFVLLPLAEIAPALVLPCGTPLAELVARCPHNDLAIIAPGADEQEPL
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaggtcttcatcgccattggttccaacctgtctgacccgctcggtcaggctcgt
cgcgccgtcgccgctctggcaaggttgccgggatccgtgctggtgcaggcctcgtcgttt
tacagcagccgccccatgggccctgctgaccagccggactacgtcaatgccgtggcccgg
ctcaacacccggctgacgccgctggcgctgctggatcaactacaaagcatcgagctggaa
caaggacgtgtgcgcaaggatgagcgatgggggccaagaaccctggatctcgatctgctg
ctgtttggcgatcagatcatcaggcatgaacgcctcatcgttccccattacggcatgaag
gagcgggagttcgtgctgctgcccctggccgagattgcacccgctctggtactgccttgc
ggcaccccactcgcagaactggttgcccgctgcccgcacaatgatcttgccatcattgcc
cccggtgcagacgaacaggagcctctatga

DBGET integrated database retrieval system